Recombinant Choristoneura pinus Cytochrome c oxidase subunit 2 (COII)

Shipped with Ice Packs
In Stock

Description

Expression and Production

The protein is produced via recombinant DNA technology, leveraging E. coli’s high-yield expression capabilities. Key production parameters include:

Key Functional Residues:

  • Copper-binding sites (His residues) critical for electron transfer.

  • Conserved transmembrane helices stabilizing interactions with COX1 and COX3 subunits .

Comparative Analysis with Related Species

Table 3: Cross-Species Comparison of COII Proteins

SpeciesIdentity (%)Unique ResiduesFunctional Notes
C. pinus100N/AHis-tagged, optimized for SDS-PAGE
C. occidentalis9112 substitutionsSimilar enzymatic kinetics
C. rosaceana8918 substitutionsVariants in substrate-binding regions

Research Applications

  • Enzymatic Studies: Used to investigate electron transport chain dysfunctions in insect mitochondrial disorders .

  • Structural Biology: Serves as a template for crystallography or cryo-EM studies of cytochrome c oxidase assembly .

  • Ecotoxicology: Potential biomarker for assessing pesticide impacts on C. pinus populations .

Limitations and Future Directions

Current data gaps include direct kinetic assays and in vivo functional validation. Future research could explore:

  • Site-directed mutagenesis to probe catalytic residues.

  • Integration into artificial lipid membranes to study proton translocation efficiency.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments default to blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
COII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Choristoneura pinus (Jack pine budworm) (Archips pinus)
Target Names
COII
Target Protein Sequence
MATWSNFNLQNSASPLMEQIIFFHDHTLVILIMITILVGYLMISLFFNSYINRFLLEGQM IELIWTILPAITLIFIALPSLRLLYLLDELNNPLITLKSIGHQWYWSYEYSDFQNIQFDS YMIPINEMKNNNFRLLDVDNRIVLPMNNQIRILVTATDVIHSWTIPSLGVKVDANPGRLN QTNFFINRPGIFYGQCSEICGANHSFMPIVIESISIKNFINWINNYS
Uniprot No.

Target Background

Function

Recombinant Choristoneura pinus Cytochrome c oxidase subunit 2 (COII) is a component of cytochrome c oxidase (Complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II, CII), ubiquinol-cytochrome c oxidoreductase (Complex III, CIII), and cytochrome c oxidase (CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred via the CuA center (subunit 2) and heme A (subunit 1) to the active site (subunit 1), a binuclear center (BNC) comprised of heme A3 and CuB. The BNC reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Choristoneura pinus Cytochrome c oxidase subunit 2 (COII)?

Choristoneura pinus Cytochrome c oxidase subunit 2 (COII) is a mitochondrial protein that forms part of respiratory chain complex IV. In Choristoneura pinus (Jack pine budworm), this protein consists of 227 amino acids and plays a crucial role in electron transport during cellular respiration. The protein is encoded by the mitochondrial genome and has been used extensively in taxonomic and phylogenetic studies of lepidopteran species, particularly within the Choristoneura genus . The recombinant form of this protein can be expressed in bacterial systems such as E. coli with an N-terminal histidine tag for purification purposes. When properly folded and functional, COII contributes to the catalytic core of cytochrome c oxidase, which is responsible for the final step of the electron transport chain where oxygen is reduced to water.

What is the taxonomic classification of Choristoneura pinus?

Choristoneura pinus, commonly known as the Jack pine budworm, is classified as follows:

  • Kingdom: Animalia

  • Phylum: Arthropoda

  • Class: Insecta

  • Order: Lepidoptera

  • Family: Tortricidae

  • Genus: Choristoneura

  • Species: C. pinus

It is also sometimes referred to as Archips pinus in older literature . Choristoneura pinus is part of the Choristoneura fumiferana species complex, which includes several closely related species that are economically important forest pests in North America . These species have historically been difficult to distinguish based solely on morphological characteristics, leading to the development of molecular markers for species identification. The Choristoneura genus contains multiple closely related species that often require molecular techniques for definitive identification, making proteins like COII valuable taxonomic markers.

How does recombinant Choristoneura pinus COII contribute to species identification?

Recombinant Choristoneura pinus COII has proven valuable for species identification within the Choristoneura genus through multiple applications:

The protein serves as a molecular marker for developing species-specific antibodies that can be used in immunological assays. Research has shown that mitochondrial DNA sequences, particularly COII and COI (Cytochrome c oxidase subunit 1), can help distinguish between closely related species that are morphologically similar . In detailed studies, a 470 bp region of COI mitochondrial DNA was found to effectively distinguish C. fumiferana and C. pinus pinus, although some other species in the complex shared haplotypes .

The recombinant protein can be used to generate reference spectra for proteomics-based species identification methods. When combined with morphometric analysis and microsatellite markers (SSRs), COII sequencing provides a more comprehensive approach to species delimitation. Research has shown that a integrated taxonomy approach using multiple markers is most effective, as mtDNA alone (including COII) may not resolve all species in the complex .

How can researchers distinguish between closely related Choristoneura species using COII?

Distinguishing between closely related Choristoneura species using COII requires a multifaceted approach:

Sequence-based differentiation involves analyzing specific variable regions within the COII gene that show fixed differences between species. This approach has successfully distinguished C. fumiferana from C. pinus pinus, though it has limitations for other species pairs that share haplotypes . Researchers should combine COII analysis with other molecular markers such as microsatellites, which have been shown to distinguish four Choristoneura species (C. fumiferana, C. pinus pinus, C. retiniana, C. lambertiana) .

Phylogenetic reconstruction using maximum likelihood or Bayesian methods can reveal evolutionary relationships and species boundaries. Since some Choristoneura species remain mixed within two populations based on SSR analysis, integrated taxonomic approaches are essential . Researchers should implement population genetic analyses to determine if COII variation correlates with other factors such as host plant specificity, geographic distribution, or reproductive barriers.

For definitive species identification, complementing COII data with morphometric analysis of forewing color components has proven effective for identification of five Choristoneura species, with only slight overlap between C. fumiferana and C. biennis .

What are the technical considerations when working with recombinant Choristoneura pinus COII?

Working with recombinant Choristoneura pinus COII requires attention to several technical considerations:

Expression optimization is crucial as the protein is typically produced as a His-tagged recombinant in E. coli . The full-length protein (amino acids 1-227) should be expressed with an N-terminal His-tag to facilitate purification while minimizing interference with protein function. Storage stability must be carefully managed; the protein is provided as a lyophilized powder and should be reconstituted according to specific protocols . After reconstitution, it is recommended to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C .

Handling protocols should include avoiding repeated freeze-thaw cycles, which can degrade the protein . Working aliquots should be stored at 4°C for up to one week . The storage buffer composition (Tris/PBS-based buffer with 6% Trehalose, pH 8.0) is specifically designed to maintain stability . Researchers should verify protein quality using SDS-PAGE, which should demonstrate greater than 90% purity .

When designing experiments, consider that the recombinant protein may lack post-translational modifications present in the native form. For functional studies, it may be necessary to evaluate the protein in a lipid environment that mimics the mitochondrial membrane.

How does COII variation correlate with ecological specialization in Choristoneura species?

COII variation in Choristoneura species demonstrates important correlations with ecological specialization:

Host plant adaptation studies have revealed that different Choristoneura species within the fumiferana complex have distinct host plant preferences, which may be reflected in adaptive changes in mitochondrial proteins like COII. These adaptations could affect energy metabolism efficiency in different host environments. Research has shown that species identification within the Choristoneura fumiferana complex has been historically challenging due to the complex interplay of morphological, ecological, behavioral, and genetic characters .

Geographic distribution patterns often correlate with COII haplotype distribution, suggesting local adaptation. For example, in isolated remnant coniferous forests like Cypress Hills in western Canada, integrated studies of behavior, ecology, morphology, and mtDNA have helped identify at least three distinct populations resembling different Choristoneura species . The correlation between COII sequences and adult flight phenology or pheromone attraction patterns suggests that mitochondrial adaptation may play a role in reproductive isolation mechanisms.

By analyzing the selective pressures on different COII regions across species with different ecological niches, researchers can identify amino acid substitutions that may be linked to adaptive divergence in metabolic function, potentially explaining how closely related species can exploit different ecological niches.

What role does recombinant COII play in understanding hybridization between Choristoneura species?

Recombinant COII serves as a valuable tool for understanding hybridization between Choristoneura species through several approaches:

Molecular marker analysis with COII sequences can identify potential hybrid zones where introgression has occurred. Research has revealed evidence for hybridization between several species pairs in the Choristoneura complex . By comparing nuclear and mitochondrial markers, researchers can detect cytonuclear discordance, which often indicates historical hybridization events. Since mitochondrial DNA is maternally inherited, COII analysis can reveal the directionality of hybridization.

Experimental studies using recombinant COII can test functional compatibility between proteins from different species, potentially revealing mechanisms of post-zygotic isolation. Protein interaction studies can determine whether COII from one species can properly interact with nuclear-encoded components of the cytochrome c oxidase complex from another species. Immunological assays using antibodies raised against recombinant COII can detect intermediate phenotypes in suspected hybrid individuals.

The patterns of COII variation across hybrid zones can provide insights into the strength of reproductive barriers and the potential for genetic exchange between Choristoneura species, contributing to our understanding of the evolutionary processes that maintain species boundaries despite some gene flow .

What expression systems are optimal for producing recombinant Choristoneura pinus COII?

The optimal expression of recombinant Choristoneura pinus COII requires careful selection of expression systems:

Bacterial expression in E. coli is the primary system documented for successful production of recombinant Choristoneura pinus COII . For optimal results, researchers should use BL21(DE3) strains which provide reduced protease activity, beneficial for mitochondrial protein expression. Expression vectors should include the T7 promoter system with an N-terminal His tag for purification, as used in the commercially available recombinant protein .

Expression conditions should be optimized by inducing at an OD600 of 0.6-0.8 with 0.1-0.5 mM IPTG. Lower temperatures (16-18°C) during induction often improve solubility of membrane proteins like COII. Extending expression periods (16-24 hours) at reduced temperatures can enhance proper folding.

For applications requiring post-translational modifications or membrane protein studies, alternative systems should be considered. Insect cell expression systems (Sf9 or High Five cells) can provide a more native environment for lepidopteran proteins. Cell-free expression systems may be advantageous for potentially toxic membrane proteins, allowing direct incorporation into artificial membrane environments.

What purification strategies are most effective for recombinant Choristoneura pinus COII?

Effective purification of recombinant Choristoneura pinus COII requires a strategic approach:

Initial capture should utilize Immobilized Metal Affinity Chromatography (IMAC) targeting the N-terminal His-tag . Use of Ni-NTA or TALON resins with optimized imidazole gradients (typically 20-250 mM) can achieve high selectivity. Wash buffers should contain low concentrations of imidazole (10-20 mM) to reduce non-specific binding while maintaining target protein retention.

Secondary purification steps should include Size Exclusion Chromatography (SEC) to separate monomeric protein from aggregates and remove remaining impurities. For membrane proteins like COII, buffers should contain appropriate detergents or amphipathic compounds to maintain solubility. Detergent screening (DDM, LMNG, digitonin) may be necessary to identify optimal conditions.

Quality control assessment should verify purity through SDS-PAGE analysis, which should demonstrate greater than 90% purity as specified in product information . Western blotting with anti-His antibodies can confirm identity, while mass spectrometry can verify the exact molecular weight and sequence integrity. For functional studies, activity assays measuring electron transfer capabilities can confirm that the purified protein retains its native conformation.

What storage conditions are recommended for recombinant Choristoneura pinus COII?

Optimal storage of recombinant Choristoneura pinus COII requires specific conditions to maintain stability:

For long-term storage, the protein should be maintained at -20°C or -80°C, with the latter preferred for extended periods . The protein is typically supplied as a lyophilized powder, which significantly enhances stability during storage . Upon receipt, working with aliquots rather than the entire stock is crucial since repeated freeze-thaw cycles cause degradation .

Buffer composition plays a critical role in stability, with the recommended storage buffer being Tris/PBS-based with 6% Trehalose at pH 8.0 . Trehalose serves as a cryoprotectant and stabilizer, protecting protein structure during lyophilization and reconstitution. After reconstitution, adding glycerol to a final concentration of 5-50% is recommended before freezing aliquots .

For short-term use, working aliquots can be stored at 4°C for up to one week . Maintaining appropriate protein concentration (typically 0.1-1.0 mg/mL) helps prevent concentration-dependent aggregation . For applications requiring repeated use, consider immobilizing the protein on affinity resins or storing in stabilized formats such as enzyme conjugates which can enhance shelf-life.

What analytical methods should be used to assess the quality of recombinant Choristoneura pinus COII?

Comprehensive quality assessment of recombinant Choristoneura pinus COII requires multiple analytical methods:

Purity assessment through SDS-PAGE is the primary method specified in product information, with greater than 90% purity being the acceptance criterion . Densitometric analysis of stained gels provides quantitative measurement of purity. Western blotting with anti-His antibodies confirms the identity of the purified protein and can detect potential degradation products.

Structural integrity analysis should include circular dichroism (CD) spectroscopy to assess secondary structure elements characteristic of properly folded COII. Thermal shift assays can evaluate protein stability and the effects of different buffer conditions. For advanced structural analysis, limited proteolysis can identify stable domains and flexible regions.

Functional verification methods should include binding assays with known interaction partners such as cytochrome c. Spectroscopic analysis can detect characteristic absorption patterns of properly folded cytochrome proteins. For definitive analysis, enzyme activity assays measuring electron transfer rates can confirm that the recombinant protein retains native functionality.

Mass spectrometry analysis should include intact mass measurement to confirm the expected molecular weight and detect any modifications. Peptide mapping through LC-MS/MS can verify sequence coverage and identify any post-translational modifications or sequence variations. These comprehensive analyses ensure that the recombinant protein accurately represents the native Choristoneura pinus COII for research applications.

How can recombinant Choristoneura pinus COII be used in evolutionary studies?

Recombinant Choristoneura pinus COII offers valuable applications in evolutionary studies:

Comparative structural analysis enables researchers to express COII proteins from multiple Choristoneura species to examine structural differences that reflect evolutionary divergence. By comparing biochemical properties (stability, activity, binding affinity), researchers can identify functional adaptations that correlate with species diversification. Antibodies generated against recombinant COII can be used in cross-reactivity studies to quantify immunological distances between species, providing an independent metric for evolutionary relationships.

Functional complementation experiments can test whether COII from one species can functionally replace that of another in in vitro or cell-based assays. Varying degrees of functional compatibility may reflect the extent of evolutionary divergence. Protein-protein interaction studies can reveal how COII interacts with other components of the respiratory chain and whether these interaction patterns differ between closely related species.

The analysis of selection pressures on different protein domains can be explored by comparing the sequences and structures of recombinant COII proteins from different Choristoneura species. Regions showing accelerated amino acid substitution rates may indicate adaptation to different ecological niches . By correlating protein-level differences with species boundaries established through DNA analysis, researchers can gain insights into the molecular basis of speciation in this economically important insect group.

What role does recombinant COII play in biodiversity assessment of forest ecosystems?

Recombinant Choristoneura pinus COII contributes significantly to biodiversity assessment in forest ecosystems through multiple approaches:

Molecular identification tools developed using recombinant COII can enable rapid and accurate identification of Choristoneura species in field samples. Given that morphological identification of these forest pests is challenging due to overlapping characteristics, protein-based identification methods offer valuable alternatives . Antibodies raised against species-specific epitopes of recombinant COII can be used in immunoassays for field-deployable detection kits.

Environmental DNA/protein analysis can be calibrated using recombinant COII standards. This allows for quantitative assessment of Choristoneura presence in environmental samples without requiring collection of whole specimens. Population genetic studies utilizing COII as a marker help assess genetic diversity and population structure of these forest pests, informing conservation and management strategies.

By monitoring changes in COII variants over time in response to forest management practices or climate change, researchers can track evolutionary responses of these important forest insects. The combination of COII data with ecological information has revealed that factors such as host plant preference, larval diapause length, and pheromone attraction patterns are important in understanding species distributions in forest ecosystems .

How can researchers use recombinant COII to investigate mitochondrial function in Choristoneura species?

Recombinant COII provides powerful tools for investigating mitochondrial function in Choristoneura species:

Functional reconstitution experiments can incorporate purified recombinant COII into artificial membrane systems to measure electron transport activity. This approach allows researchers to compare the catalytic efficiency of COII from different Choristoneura species under controlled conditions. Structure-function analysis can identify key amino acid residues that determine functional properties by creating site-directed mutants of recombinant COII.

Interaction studies with other respiratory chain components can reveal how COII contributes to the assembly and stability of respiratory complexes. Antibodies generated against recombinant COII can be used in immunolocalization studies to examine the distribution and abundance of COII in different tissues and developmental stages.

Environmental adaptation studies can investigate how COII function responds to various stressors (temperature, pH, xenobiotics) that insects encounter in their natural habitats. By measuring the thermostability and pH-dependence of recombinant COII from different Choristoneura species, researchers can identify potential adaptations to different environmental conditions. These functional studies complement genetic analyses and provide insights into how mitochondrial adaptations contribute to the ecological success of different Choristoneura species.

What methodological approaches can improve the yield of functional recombinant Choristoneura pinus COII?

Improving the yield of functional recombinant Choristoneura pinus COII requires systematic optimization:

Expression system enhancement should focus on codon optimization for E. coli expression, as insect genes often contain codons rarely used in bacteria. Using specialized E. coli strains such as Rosetta or CodonPlus that supply rare tRNAs can significantly improve expression levels. Optimizing the vector design by incorporating strong ribosome binding sites and removing secondary structures in the mRNA can enhance translation efficiency.

Culture condition optimization should include screening different media formulations, with defined media often providing more consistent results than complex media for membrane proteins. Temperature reduction during induction (to 16-18°C) slows protein synthesis and allows more time for proper folding. Induction strategies should be tuned by testing various IPTG concentrations (0.1-1.0 mM) and induction times (4-24 hours).

For enhanced folding, co-expression with molecular chaperones (GroEL/ES, DnaK/J/GrpE) can significantly improve the yield of correctly folded protein. Adding specific ligands or cofactors during expression may stabilize the nascent protein. For extraction optimization, screening different detergents and solubilization conditions is crucial for membrane proteins like COII.

Post-expression processing should include optimized purification protocols with minimal steps to reduce yield losses. On-column refolding during purification can recover active protein from inclusion bodies. Final formulation in stabilizing buffers containing trehalose (as used in the commercial product) protects against denaturation during storage and handling .

How can researchers integrate COII protein data with genomic information for comprehensive species analysis?

Integrating COII protein data with genomic information requires multidisciplinary approaches:

Sequence-structure-function correlation involves mapping sequence variations in COII genes to structural features and functional properties of the protein. This allows researchers to identify which genetic changes have functional consequences versus those that are neutral. By combining recombinant COII protein analysis with whole-genome sequencing data from different Choristoneura species, researchers can place COII variation in the context of genome-wide divergence patterns.

Transcriptomic integration can reveal how COII expression varies across tissues, developmental stages, and environmental conditions. Correlating these expression patterns with protein abundance and activity provides insights into regulatory mechanisms. Proteomic approaches using recombinant COII as a standard can enable accurate quantification of COII in complex biological samples.

Machine learning algorithms can be applied to integrated datasets to identify patterns that distinguish different Choristoneura species. These computational approaches can detect subtle correlations between genetic, protein-level, and phenotypic data that might not be apparent through conventional analysis. Network analysis incorporating COII and its interaction partners can reveal how mitochondrial function is integrated with other cellular processes and how these networks differ between species.

The successful integration of multiple data types has been demonstrated in studies of the Choristoneura fumiferana complex, where combining morphological, ecological, behavioral, and genetic characters provided a more complete understanding of species boundaries than any single data type alone .

What bioinformatic tools are most effective for analyzing COII sequence-structure relationships?

Effective analysis of COII sequence-structure relationships requires specialized bioinformatic tools:

Sequence analysis should begin with multiple sequence alignment tools such as MUSCLE, MAFFT, or T-Coffee to align COII sequences from different species. Conservation analysis tools like ConSurf can map evolutionary conservation onto protein structures, identifying functionally important regions. Selective pressure analysis using PAML or HyPhy can detect sites under positive or purifying selection.

Structure prediction tools including AlphaFold2 or RoseTTAFold can generate accurate structural models of COII from different Choristoneura species. These models can be compared using structural alignment tools like TM-align or DALI to quantify structural divergence. Molecular visualization software such as PyMOL or UCSF Chimera allows mapping of sequence variations onto 3D structures.

Molecular dynamics simulations can provide insights into how sequence variations affect protein dynamics and stability. Protein-protein docking tools like HADDOCK or ClusPro can predict interaction interfaces between COII and other respiratory chain components. Energy calculation tools can estimate the impact of mutations on protein stability and function.

Machine learning approaches including deep learning models can identify complex patterns in sequence-structure relationships that might not be apparent through traditional analysis. Integrative platforms that combine multiple analysis tools, such as Galaxy or Jalview, facilitate comprehensive analysis workflows. These bioinformatic approaches complement experimental studies with recombinant proteins and can guide the design of functional experiments to test specific hypotheses about COII evolution and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.