Recombinant Choristoneura rosaceana Cytochrome c oxidase subunit 1 (COI)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant COI is produced via heterologous expression systems, with variations in yield and structural fidelity:

Expression SystemProtein LengthPurityTagSourceReference
E. coliFull-length (1–274 aa)>90% (SDS-PAGE)His-tagLyophilized powder
BaculovirusPartial>85% (SDS-PAGE)UndeterminedLiquid form
Mammalian cellsPartial>85% (SDS-PAGE)UndeterminedLiquid form

Key production steps:

  1. Cloning: COI coding sequence (P50671) is inserted into prokaryotic (e.g., E. coli) or eukaryotic (e.g., insect cells, mammalian cells) expression vectors .

  2. Expression: Induced via IPTG (bacterial systems) or viral infection (baculovirus systems) .

  3. Purification: His-tagged COI is purified using Ni-NTA affinity chromatography, followed by buffer exchange and lyophilization .

Applications in Research and Diagnostics

Recombinant COI serves as a critical tool in mitochondrial biology and applied sciences:

Biochemical Assays

  • SDS-PAGE analysis: Used to verify protein integrity (>90% purity) .

  • Enzyme activity studies: Assesses electron transfer and proton pumping in vitro .

Immunological Tools

  • ELISA antigen: Employed in immunoassays to detect COI-specific antibodies in pest species or model organisms .

Disease Modeling

  • Mitochondrial disorders: COI mutations (e.g., in MT-CO1) are linked to Leber’s hereditary optic neuropathy and Complex IV deficiency . Recombinant COI aids in studying these pathologies.

Comparative Analysis of Recombinant COI Variants

FeatureE. coli-Produced COIBaculovirus-Produced COIMammalian Cell-Produced COI
Protein LengthFull-length (1–274 aa)PartialPartial
Post-Translational ModificationsLimited (e.g., no glycosylation)More authentic (e.g., insect-specific modifications)Most authentic (e.g., mammalian-like modifications)
Cost-EffectivenessHigh yield, low costModerate yield, higher costLow yield, highest cost

Research Findings and Functional Insights

  1. Proton Pumping Mechanism: COI’s transmembrane domains facilitate proton translocation during electron transfer, a process critical for ATP synthesis .

  2. Assembly Dependencies: COI requires chaperones (e.g., COX assembly factors) for proper folding and integration into Complex IV .

  3. Pest Management: Recombinant COI may inform strategies to disrupt mitochondrial function in C. rosaceana, reducing agricultural damage .

Challenges and Future Directions

  • Structural Limitations: Partial COI variants lack critical functional domains, necessitating full-length production for accurate biochemical studies .

  • Therapeutic Potential: Mutant COI proteins could model mitochondrial diseases, enabling drug screening for Complex IV deficiencies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
COI; Cytochrome c oxidase subunit 1; Cytochrome c oxidase polypeptide I; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-274
Protein Length
full length protein
Species
Choristoneura rosaceana (Oblique banded leafroller)
Target Names
COI
Target Protein Sequence
PEVYILILPGFGMISHIISQESGKKETFGCLGMIYAMMAIGLLGFVVWAHHMFTVGMDID TRAYFTSATMIIAVPTGIKIFSWLATLHGTQINYSPSMLWSLGFVFLFTVGGLTGVILAN SSIDVTLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWYPLFTGLAMNPYLLKIQFFTMFIG VNLTFFPQHFLGLAGMPRRYSDYPDIYTSWNIISSLGSYISLIATMLMLMIIWESLINKR IILFPLNMNSSIEWYQNLPPAEHSYNELPILSNF
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 1 (COI) is a component of cytochrome c oxidase, the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes cooperate to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) consisting of heme A3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Heme-copper respiratory oxidase family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Choristoneura rosaceana and why is its COI protein significant for research?

Choristoneura rosaceana (oblique-banded leaf roller) is a polyphagous moth species in the Tortricidae family that affects over 80 plant species across 24 plant families. It is categorized as an A1 Quarantine pest by both EPPO and EU regulatory frameworks . The Cytochrome c Oxidase Subunit 1 (COI) protein from this species is significant in research because:

  • It serves as a molecular marker for species identification and delimitation within the Choristoneura genus

  • It provides insights into phylogenetic relationships among tortricid moths

  • It can be used as a reference for studying evolutionary relationships and population genetics

  • The recombinant form allows for controlled experimental studies without requiring collection of wild specimens

The protein's 274-amino acid sequence is well-characterized, making it valuable for comparative studies in insect molecular biology and evolution .

How is recombinant C. rosaceana COI protein typically expressed and purified?

The recombinant C. rosaceana COI protein is typically expressed in E. coli expression systems using the following methodological approach:

  • The full-length coding sequence (1-274 amino acids) is cloned into an expression vector with an N-terminal His-tag

  • Expression is induced in E. coli under optimized conditions (typically using IPTG induction)

  • Bacterial cells are harvested and lysed using mechanical or chemical methods

  • The protein is purified using nickel affinity chromatography, exploiting the His-tag

  • Further purification may involve ion-exchange or size-exclusion chromatography

  • The purified protein is then typically lyophilized for storage stability

The resulting product achieves >90% purity as determined by SDS-PAGE analysis. For optimal results, the purified protein is stored in Tris/PBS-based buffer containing 6% trehalose at pH 8.0 .

What is the correct reconstitution procedure for lyophilized recombinant C. rosaceana COI protein?

For optimal reconstitution of lyophilized recombinant C. rosaceana COI protein, follow this methodological procedure:

  • Centrifuge the vial briefly to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended as default)

  • Aliquot the reconstituted protein for long-term storage

  • Store working aliquots at 4°C for up to one week

  • Store long-term aliquots at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as these can compromise protein integrity

This approach maintains protein stability while enabling multiple experimental uses from a single preparation .

How can recombinant C. rosaceana COI be used in species delimitation studies?

Recombinant C. rosaceana COI protein can serve as a valuable reference standard in species delimitation studies using the following methodological approach:

  • Antibody production: Use the recombinant protein to generate specific antibodies that can detect native COI in field samples

  • Standard curve establishment: Create calibration curves using the recombinant protein for quantitative assays

  • Structural analysis: Compare the recombinant protein with native samples to identify structural conservation or variation

  • Functional assays: Develop activity assays to assess functional differences between related species

This approach is particularly valuable when integrating morphological and molecular data for species identification within cryptic species complexes, similar to methodologies used for the spruce budworm (Choristoneura fumiferana) complex . The recombinant protein provides a reliable reference point against which field samples can be compared, helping resolve taxonomic uncertainties in closely related species.

What are the most effective experimental approaches for using recombinant COI in molecular phylogeny studies?

For molecular phylogeny studies utilizing recombinant C. rosaceana COI, researchers should employ these methodological approaches:

  • Sequence comparison analysis:

    • Use the recombinant protein's known sequence as a reference for alignment with COI sequences from related species

    • Employ multiple sequence alignment tools (e.g., MUSCLE, CLUSTAL) to identify conserved and variable regions

    • Generate phylogenetic trees using maximum likelihood, Bayesian inference, or neighbor-joining methods

  • Structural homology modeling:

    • Use the recombinant protein to determine structural features that may be phylogenetically informative

    • Compare structural conservation across related species

    • Identify functional domains that show evolutionary conservation or divergence

  • Immunological cross-reactivity studies:

    • Develop antibodies against the recombinant protein

    • Test cross-reactivity patterns across related species

    • Use immunological distance as a complementary phylogenetic marker

These approaches have proven effective in delimiting species within the Choristoneura genus, where traditional morphological approaches alone may be insufficient for distinguishing cryptic species .

How should researchers design experiments to compare recombinant versus native C. rosaceana COI?

When designing experiments to compare recombinant versus native C. rosaceana COI, implement this methodological framework:

  • Sample preparation:

    • Extract native COI from freshly collected C. rosaceana specimens using standardized protocols

    • Ensure recombinant COI is properly reconstituted following recommended procedures

    • Normalize protein concentrations for direct comparison

  • Analytical comparisons:

    • Perform SDS-PAGE analysis to compare apparent molecular weights

    • Conduct Western blot analysis using anti-His antibodies (for recombinant protein) and anti-COI antibodies (for both)

    • Employ circular dichroism spectroscopy to compare secondary structure elements

    • Use mass spectrometry to identify potential post-translational modifications present in native but not recombinant protein

  • Functional assays:

    • Develop activity assays based on cytochrome c oxidase function

    • Compare kinetic parameters between native and recombinant forms

    • Assess thermal stability and pH response profiles

  • Data analysis:

    • Apply statistical tests appropriate for paired comparisons

    • Quantify differences using both parametric and non-parametric approaches

    • Report effect sizes in addition to statistical significance

This comprehensive approach enables accurate assessment of how well the recombinant protein represents the native form, validating its use in downstream applications.

How can recombinant C. rosaceana COI be used to study adaptive evolution in pest populations?

To leverage recombinant C. rosaceana COI for studying adaptive evolution in pest populations, implement this advanced research methodology:

  • Sequence variant library creation:

    • Generate a library of recombinant COI variants reflecting known population polymorphisms

    • Express and purify variant proteins using consistent protocols

    • Characterize functional properties of each variant

  • Selection pressure analysis:

    • Compare recombinant proteins representing COI from populations under different selection pressures

    • Analyze the ratio of non-synonymous to synonymous substitutions (dN/dS) to identify regions under selection

    • Map variable regions to the protein structure to identify functional implications

  • Biochemical characterization:

    • Measure enzymatic efficiency of different variants under varying conditions (temperature, pH)

    • Assess protein stability differences that might confer adaptive advantages

    • Quantify binding affinities to relevant interaction partners

  • Population genetics integration:

    • Correlate biochemical findings with population distribution data

    • Test hypotheses about selective advantages of specific variants in different agricultural environments

    • Model how protein functional changes might influence population dynamics

This approach provides mechanistic insights into how molecular evolution at the COI locus potentially contributes to adaptation in C. rosaceana populations, particularly in response to changing agricultural landscapes or control measures.

What methodological approaches can resolve contradictory results between COI-based and morphology-based species identification?

When facing contradictions between COI-based and morphology-based species identification, researchers should implement this systematic resolution approach:

  • Integrated data collection:

    • Ensure specimens used for morphological and molecular analyses are the same individuals

    • Document detailed morphological characteristics using standardized photography and measurements

    • Sequence the COI gene and express the recombinant protein from the same specimens

  • Multi-marker verification:

    • Complement COI data with other molecular markers (nuclear genes, microsatellites)

    • Use recombinant COI as a reference standard for antibody production and immunological assays

    • Compare results across multiple identification methods

  • Statistical integration framework:

    • Apply Bayesian statistical approaches to integrate morphological and molecular data

    • Implement machine learning algorithms to identify patterns not apparent through conventional analysis

    • Quantify uncertainty in both morphological and molecular identification methods

  • Experimental validation:

    • Conduct breeding experiments to test reproductive isolation hypotheses

    • Use recombinant COI in functional assays to test for physiological differences

    • Perform ecological studies to assess niche differentiation

This integrated approach has successfully resolved taxonomic uncertainties in the spruce budworm complex, where morphological characteristics alone were insufficient for reliable species delimitation . By combining multiple lines of evidence and rigorously testing alternative hypotheses, researchers can resolve apparent contradictions and establish more robust taxonomic frameworks.

A comparison of COI-based and morphology-based identification approaches for Choristoneura species

FeatureCOI-Based IdentificationMorphology-Based IdentificationIntegrated Approach
Sensitivity to cryptic speciesHighLow to moderateVery high
Technical expertise requiredMolecular biology skillsTaxonomic expertiseBoth skillsets
Equipment needsPCR, sequencing, protein expressionMicroscopy, imagingComprehensive lab setup
Sample preparation time1-3 daysHours to days2-4 days
Cost per specimen$20-100$5-30$30-150
Ambiguity resolution capacityModerateModerateHigh
Application in field conditionsLimitedModerateLimited
Taxonomic resolution powerSpecies/subspecies levelVaries (species to family)Species/population level

How can researchers address solubility issues with recombinant C. rosaceana COI protein?

When encountering solubility challenges with recombinant C. rosaceana COI protein, implement this systematic troubleshooting methodology:

  • Buffer optimization:

    • Test a range of pH conditions (6.0-9.0) to identify optimal solubility

    • Evaluate different buffer systems (Tris, phosphate, HEPES) for compatibility

    • Add solubility enhancers such as arginine (50-200 mM) or glycerol (5-20%)

    • Consider detergents for this membrane-associated protein (0.01-0.1% non-ionic detergents like Triton X-100 or NP-40)

  • Expression condition modifications:

    • Reduce expression temperature (16-18°C)

    • Decrease inducer concentration to slow expression rate

    • Co-express with molecular chaperones (GroEL/GroES, DnaK/DnaJ)

    • Consider fusion partners known to enhance solubility (MBP, SUMO, TrxA)

  • Refolding approaches:

    • If inclusion bodies form, develop a denaturation/refolding protocol

    • Implement step-wise dialysis to gradually remove denaturants

    • Add stabilizing agents during refolding (arginine, low concentrations of guanidine)

    • Monitor refolding efficiency using activity assays or structural analyses

  • Advanced solubilization strategies:

    • Use specialized commercial protein extraction kits designed for membrane proteins

    • Consider mild solubilization with sarkosyl followed by dilution into non-ionic detergents

    • Test high-salt conditions (300-500 mM NaCl) to disrupt non-specific interactions

This methodological approach addresses the inherent challenges associated with expressing membrane-associated proteins like COI in bacterial systems, improving yield of functional protein for research applications.

What quality control methods should be implemented when working with recombinant C. rosaceana COI?

Implement this comprehensive quality control methodology when working with recombinant C. rosaceana COI protein:

  • Purity assessment:

    • Perform SDS-PAGE analysis with densitometry to quantify purity (target >90%)

    • Conduct size-exclusion chromatography to detect aggregation or oligomerization

    • Use mass spectrometry to confirm identity and detect potential contaminants

    • Apply Western blot analysis with anti-His and anti-COI antibodies to confirm target protein

  • Structural integrity validation:

    • Employ circular dichroism spectroscopy to assess secondary structure

    • Use intrinsic fluorescence to evaluate tertiary structure

    • Apply thermal shift assays to determine stability profiles

    • Consider limited proteolysis to verify proper folding

  • Functional characterization:

    • Develop activity assays based on cytochrome c oxidase function

    • Compare activity to established standards when available

    • Assess binding to known interaction partners

    • Verify immunological reactivity with specific antibodies

  • Batch consistency monitoring:

    • Maintain detailed records of expression and purification parameters

    • Establish acceptance criteria for each quality parameter

    • Archive reference samples from successful preparations

    • Implement regular comparative analyses between batches

This systematic quality control approach ensures that experimental outcomes are based on properly characterized protein preparations, enhancing reproducibility and reliability of research findings.

How can recombinant C. rosaceana COI be used in developing molecular tools for pest management?

Recombinant C. rosaceana COI protein can be strategically utilized in developing molecular tools for pest management through the following methodological framework:

  • Molecular diagnostic development:

    • Use the recombinant protein to generate specific antibodies for immunodiagnostic assays

    • Develop ELISA or lateral flow assays for rapid field detection

    • Create standardized qPCR assays with recombinant DNA as positive controls

    • Establish isothermal amplification methods (LAMP) for field-deployable diagnostics

  • Population monitoring tools:

    • Generate protein-based markers for tracking population movements

    • Develop COI-specific probes for environmental DNA (eDNA) detection

    • Create reference standards for metabarcoding approaches in ecological surveys

    • Design multiplexed detection systems for simultaneous identification of multiple pest species

  • Resistance monitoring applications:

    • Express variant COI proteins representing resistant populations

    • Develop assays to detect emerging mutations associated with resistance

    • Create biosensors for detecting specific COI variants in field populations

    • Establish high-throughput screening methods for population-level monitoring

  • Integration with existing management frameworks:

    • Correlate molecular data with traditional monitoring approaches

    • Develop decision support tools based on molecular detection thresholds

    • Create spatial mapping tools that incorporate molecular detection data

    • Design early warning systems based on molecular surveillance

This approach enables development of next-generation pest management strategies that incorporate molecular information for more precise and effective interventions, potentially similar to methods being developed for other pest species like Helicoverpa armigera .

What are the methodological considerations for comparing COI proteins across different Choristoneura species?

When comparing COI proteins across different Choristoneura species, researchers should implement these methodological considerations:

  • Standardized expression and purification:

    • Use identical expression systems for all species' COI proteins

    • Implement consistent purification protocols to minimize methodology-induced variations

    • Validate protein folding and activity using consistent assays

    • Prepare all proteins simultaneously when possible to minimize batch effects

  • Comprehensive sequence analysis:

    • Perform multiple sequence alignments to identify conserved and variable regions

    • Calculate sequence identity and similarity percentages

    • Identify species-specific sequence signatures

    • Map variations to functional domains using structural models

  • Structural comparison approaches:

    • Generate homology models for each species variant

    • Perform molecular dynamics simulations to assess functional implications of variations

    • Use circular dichroism spectroscopy to compare secondary structure elements

    • Apply thermal shift assays to identify stability differences

  • Functional differentiation analysis:

    • Develop standardized enzymatic assays applicable across variants

    • Compare kinetic parameters under identical conditions

    • Assess protein-protein interaction profiles

    • Evaluate responses to inhibitors or environmental stressors

This methodological framework enables meaningful comparisons across the Choristoneura genus, similar to approaches used in the spruce budworm complex studies , providing insights into evolutionary relationships and potentially revealing species-specific vulnerabilities that could inform pest management strategies.

How might advances in recombinant protein technology impact future research on C. rosaceana COI?

Emerging advances in recombinant protein technology will significantly impact future C. rosaceana COI research through these methodological innovations:

  • Cell-free expression systems:

    • Implementation of cell-free protein synthesis for rapid production

    • Incorporation of non-canonical amino acids for specialized functional studies

    • Development of high-throughput expression platforms for variant libraries

    • Integration with microfluidic systems for automated production and screening

  • Structural biology applications:

    • Application of AlphaFold2 and other AI-based structure prediction tools

    • Development of cryo-EM methodologies for membrane protein complexes

    • Integration of hydrogen-deuterium exchange mass spectrometry for dynamic studies

    • Implementation of single-molecule biophysics approaches

  • Synthetic biology approaches:

    • Engineering of orthogonal COI variants with modified functions

    • Development of biosensors based on COI structural elements

    • Creation of chimeric proteins to study domain-specific functions

    • Design of protein switches using COI structural frameworks

  • Field-applicable technologies:

    • Development of lyophilized cell-free systems for on-site protein production

    • Creation of paper-based analytical platforms using recombinant proteins

    • Implementation of smartphone-integrated detection systems

    • Design of environmental sampling tools with integrated molecular detection

These methodological advances will enable more sophisticated research applications while simultaneously making the technology more accessible for field applications, bridging the gap between fundamental research and practical pest management tools.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.