Recombinant Chromobacterium violaceum Apolipoprotein N-acyltransferase (lnt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. If you have a specific format preference, please specify your requirement in the order notes. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please communicate it to us. We will prioritize developing the specified tag type if possible.
Synonyms
lnt; CV_4154; Apolipoprotein N-acyltransferase; ALP N-acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-516
Protein Length
full length protein
Species
Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)
Target Names
lnt
Target Protein Sequence
MLNAAGGAGCDPSSPTATSPMRILILLLAAALAGAFTLFAFAPYRLFWLMPLCLAALVEL LQREPRRAFWLGYAWGLGAYVSNFRWIYDSLHDVAGLPAWIAAPLVLLLPAYLALYPGLA SWLACRIDPRPGVRWLLAFPAAWELGEWLRGWVMTGFPWGAAGYSQITESPLAGYAPLGG IHLVNYLVALSAAALAMLARAGMRQRIGILIAAALAWGSGVWLRDIEWTTPAGKPITVAL AQGNIAQELKWSPENLENSLLTYYRQVAMTRADLMILPETALPLFLDDLPSGYLSMMRGE ASRAGMALASGIPRRTDDGRGYLNSVVALSDPKMPYYAKDHLVPFGEFVPLPGLIGWIYQ HMDMPLSGFTRGGADQPPLTLAGQKVAFNVCYEDSFGEELIGPASRAGMLANVSNLAWFG KSEAMSQHLQLSQARSLETGRYMLRATNNGMTAIIRPDGEISAVAAPFTAQVLTGFAQSR QGLTPYMRFGNLPVVLGCGALLLLALLLGWRRRGQH
Uniprot No.

Target Background

Function
Apolipoprotein N-acyltransferase (lnt) from Chromobacterium violaceum catalyzes the phospholipid-dependent N-acylation of the N-terminal cysteine of apolipoprotein. This is the final step in lipoprotein maturation.
Database Links

KEGG: cvi:CV_4154

STRING: 243365.CV_4154

Protein Families
CN hydrolase family, Apolipoprotein N-acyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Apolipoprotein N-acyltransferase (lnt) in Chromobacterium violaceum?

Apolipoprotein N-acyltransferase (lnt) from Chromobacterium violaceum is a membrane-bound enzyme encoded by the lnt gene (also known as CV_4154). It belongs to the family of enzymes responsible for the final step in bacterial lipoprotein maturation. The full-length protein consists of 516 amino acids and includes characteristic transmembrane domains. Structurally, the protein features multiple hydrophobic regions consistent with its membrane localization, as evidenced by its amino acid sequence which includes several transmembrane helices and a catalytic domain . This enzyme catalyzes the N-acylation of apolipoproteins, a critical process for proper lipoprotein anchoring and function in the bacterial cell envelope.

How does the protein structure of C. violaceum lnt compare with homologous proteins in other bacterial species?

The Chromobacterium violaceum lnt protein (UniProt ID: Q7NQI3) shares significant structural similarities with apolipoprotein N-acyltransferases from other Gram-negative bacteria, particularly in the catalytic domains. The full-length protein (516 amino acids) contains characteristic membrane-spanning regions and conserved active site residues. Analysis of the amino acid sequence reveals several hydrophobic segments consistent with the transmembrane topology observed in other bacterial lnt proteins . The primary sequence demonstrates evolutionary conservation of key catalytic residues, though C. violaceum lnt may possess unique structural features that could influence substrate specificity or membrane association. These potential differences may contribute to C. violaceum's distinctive adaptations, possibly related to its ability to produce secondary metabolites like violacein.

What are the optimal conditions for expressing recombinant C. violaceum lnt in E. coli expression systems?

For optimal expression of recombinant C. violaceum Apolipoprotein N-acyltransferase in E. coli, researchers should consider several critical parameters. The protein is typically expressed as a His-tagged fusion protein (N-terminal tag) in E. coli expression systems . Based on standard protocols for membrane proteins, expression should be conducted at lower temperatures (16-25°C) after induction with reduced IPTG concentrations (0.1-0.5 mM) to minimize formation of inclusion bodies. Since lnt is a membrane protein, E. coli strains specialized for membrane protein expression, such as C41(DE3) or C43(DE3), often yield better results than standard BL21(DE3) strains. The addition of membrane-stabilizing agents like glycerol (2-5%) to growth media can improve protein folding and stability. Expression vectors providing moderate transcription rates, such as pET series with T7lac promoters, are preferable to prevent overwhelming the membrane insertion machinery.

What purification strategies are most effective for isolating active C. violaceum lnt protein?

Purification of active C. violaceum Apolipoprotein N-acyltransferase requires specialized approaches due to its membrane-associated nature. The recommended purification protocol begins with cell lysis using either sonication or high-pressure homogenization in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, and protease inhibitors . Membrane fractions should be isolated by ultracentrifugation (100,000 × g for 1 hour) followed by solubilization using detergents—typically 1-2% n-dodecyl-β-D-maltoside (DDM) or 1% lauryl maltose neopentyl glycol (LMNG) for 2-3 hours at 4°C. For His-tagged protein purification, immobilized metal affinity chromatography with Ni-NTA resin is performed in buffer containing 0.03-0.05% DDM or 0.01% LMNG to maintain protein solubility. Sequential washing with increasing imidazole concentrations (20-50 mM) removes non-specific binding proteins before elution with 250-300 mM imidazole. Size exclusion chromatography as a final polishing step yields >90% pure protein suitable for functional and structural studies.

What assays are available for measuring C. violaceum lnt enzymatic activity?

Several complementary assays can be employed to measure the enzymatic activity of Chromobacterium violaceum Apolipoprotein N-acyltransferase. The most direct approach utilizes a fluorescence-based assay with FRET-labeled peptide substrates containing the conserved lipobox motif. Enzymatic N-acylation results in measurable fluorescence changes as the reaction progresses. Alternatively, a radioactive assay using [³H]-labeled or [¹⁴C]-labeled phospholipids as acyl donors can quantify the transfer of acyl chains to synthetic apolipoprotein substrates, with reaction products separated by thin-layer chromatography. For higher-throughput analysis, a modified HPLC method can detect the formation of N-acylated lipoproteins using synthetic peptide substrates. Enzymatic activity should be measured in buffer systems containing 50 mM HEPES (pH 7.5), 100-150 mM NaCl, and 0.03% DDM detergent to maintain protein solubility while preserving native-like membrane environments . When designing activity assays, researchers should ensure proper protein reconstitution in detergent micelles or lipid nanodiscs to preserve the native conformation essential for catalytic function.

How stable is purified recombinant C. violaceum lnt under various storage conditions?

The stability of purified recombinant C. violaceum Apolipoprotein N-acyltransferase varies significantly under different storage conditions. According to experimental data, the protein demonstrates highest stability when stored in buffer containing 50 mM Tris/PBS (pH 8.0) supplemented with 6% trehalose at -80°C . Under these conditions, the protein retains >90% activity for up to 6 months. Storage at -20°C is less optimal but can maintain approximately 70-75% activity for 1-2 months when properly aliquoted. The protein is notably sensitive to freeze-thaw cycles, with each cycle resulting in approximately 15-20% loss of activity. For short-term storage (up to one week), samples can be maintained at 4°C with minimal loss of activity. Addition of glycerol (final concentration 5-50%) is strongly recommended for long-term storage, with 50% being optimal for preventing ice crystal formation that can denature membrane proteins . For working with the protein, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended, followed by addition of glycerol and aliquoting to minimize repeated freeze-thaw cycles.

What computational approaches are most effective for predicting substrate binding sites in C. violaceum lnt?

Computational prediction of substrate binding sites in C. violaceum Apolipoprotein N-acyltransferase requires specialized approaches for membrane proteins. The most effective computational strategy combines homology modeling with molecular dynamics simulations in explicit membrane environments. Initial models should be built using experimentally determined structures of homologous bacterial lnt proteins as templates, with particular attention to the conservation of catalytic residues. Molecular dynamics simulations in POPC (1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine) or mixed lipid bilayers over extended timescales (>100 ns) help refine the model and identify stable substrate binding pockets. Binding site prediction algorithms specifically optimized for membrane proteins, such as COACH-D or MemSAM, can identify potential substrate docking sites based on geometric and physicochemical properties. These predictions should be validated using site-directed mutagenesis of proposed binding site residues, followed by experimental activity assays. Docking simulations with known substrates, including various phospholipids and apolipoprotein peptides containing the lipobox motif, provide additional insights into substrate specificity. Machine learning approaches trained on related acyltransferases can further refine predictions when sufficient training data is available.

What is the relationship between lnt expression and violacein production in C. violaceum?

The relationship between Apolipoprotein N-acyltransferase (lnt) expression and violacein production in Chromobacterium violaceum represents an intriguing yet unexplored area of bacterial physiology. While direct experimental evidence linking these two processes is not extensively documented in the literature, several mechanisms potentially connect them. Violacein production in C. violaceum is regulated by multiple systems, including the CviI/R quorum sensing system and the VioS repressor . The antibiotic-induced response (air) two-component regulatory system also influences violacein synthesis in response to translation-inhibiting antibiotics . The lnt protein, essential for proper lipoprotein processing and membrane integrity, likely interfaces with these regulatory networks at multiple levels. Translation-inhibiting antibiotics that induce violacein production may simultaneously affect lnt expression as part of a broader stress response. The proper functioning of membrane-associated quorum sensing components depends on the correct processing of membrane lipoproteins, potentially creating a functional dependency between lnt activity and quorum sensing regulation of violacein. Furthermore, both systems may respond coordinately to environmental stressors, suggesting evolutionary integration of these pathways.

How can C. violaceum lnt be utilized in studies of bacterial lipoprotein trafficking?

Recombinant Chromobacterium violaceum Apolipoprotein N-acyltransferase (lnt) serves as an excellent model system for investigating bacterial lipoprotein trafficking mechanisms. To effectively utilize this protein, researchers should consider several experimental approaches. A fluorescent lipoprotein trafficking assay can be designed by creating fusion proteins combining a lipoprotein signal sequence with fluorescent proteins like GFP or mCherry. When expressed in cells with wild-type or modified lnt activity, these constructs allow real-time visualization of lipoprotein localization and trafficking. For in vitro reconstitution studies, purified recombinant lnt protein can be incorporated into artificial membrane systems (liposomes or nanodiscs) along with other lipoprotein processing enzymes (Lgt and LspA) to recreate the complete lipoprotein maturation pathway. This system allows detailed kinetic analysis of each processing step. Comparative studies between C. violaceum lnt and homologs from other bacterial species can reveal species-specific differences in substrate specificity and processing efficiency. Chemical biology approaches using activity-based protein profiling with derivatized phospholipid probes can map the lnt active site and identify key catalytic residues. These techniques collectively provide comprehensive insights into bacterial lipoprotein trafficking mechanisms.

What are the potential applications of C. violaceum lnt in synthetic biology?

Chromobacterium violaceum Apolipoprotein N-acyltransferase offers several innovative applications in synthetic biology research. The enzyme can be employed to create customized surface display systems by engineering fusion proteins that combine payload proteins with lipoprotein signal sequences, enabling their anchoring to bacterial cell surfaces after lnt-mediated processing. This technology has potential applications in whole-cell biocatalysis, biosensors, and vaccine development. For lipid bioengineering, the substrate specificity of C. violaceum lnt can be exploited to incorporate non-natural fatty acids into lipoproteins, creating novel biomolecules with altered properties. In engineered minimal cells, the lnt gene represents an essential component for reconstructing functional membrane systems, as proper lipoprotein processing is critical for membrane integrity and function. The enzyme's catalytic mechanism provides a blueprint for designing synthetic acyltransferases with novel specificities for biotechnological applications. Additionally, controlled expression of C. violaceum lnt can be integrated into genetic circuits regulating membrane composition in response to environmental signals, creating adaptive bacterial systems for biotechnological applications.

What are common issues in heterologous expression of C. violaceum lnt and their solutions?

Heterologous expression of Chromobacterium violaceum Apolipoprotein N-acyltransferase frequently encounters several challenges that require specific troubleshooting approaches. Protein toxicity in E. coli expression systems can be addressed by using tightly controlled inducible promoters, reducing expression temperature to 16-18°C, and utilizing specialized E. coli strains like C41(DE3) designed for toxic membrane proteins . Low protein yield, a common issue with membrane proteins, can be improved by optimizing codon usage for the expression host, incorporating fusion partners like MBP or SUMO that enhance solubility, and using enriched media formulations. Protein misfolding can be minimized by co-expression with molecular chaperones (GroEL/GroES or DnaK/DnaJ/GrpE systems) and inclusion of membrane-mimetic environments during extraction and purification. Aggregation during purification is often resolved by careful detergent selection—testing multiple detergents (DDM, LMNG, LDAO) at various concentrations is recommended. Loss of activity during purification can be prevented by including stabilizing agents like glycerol (10-20%) and specific lipids (E. coli total lipid extract at 0.1-0.2 mg/ml) in purification buffers, while maintaining strict temperature control (4°C throughout the purification process) .

How can researchers troubleshoot inconsistent enzymatic activity in C. violaceum lnt assays?

Inconsistent enzymatic activity in Chromobacterium violaceum Apolipoprotein N-acyltransferase assays can arise from multiple factors, each requiring specific troubleshooting approaches. Buffer composition significantly impacts activity—researchers should verify pH stability (optimal range 7.0-8.0) and ensure proper ionic strength (100-150 mM NaCl). Detergent-related issues are common; excessive detergent concentrations can disrupt enzyme-substrate interactions, while insufficient amounts may cause protein aggregation. Testing detergent concentrations (typically 1-3× critical micelle concentration) and types (DDM, LMNG, or digitonin) can resolve these issues . Substrate preparation problems, particularly poor solubility of lipid substrates, can be addressed by proper sonication or extrusion methods to ensure uniform dispersion. Enzyme inactivation during storage manifests as declining activity over time and can be minimized by adding stabilizers like glycerol (50%) and trehalose (6%), avoiding freeze-thaw cycles, and storing small aliquots at -80°C . Cofactor requirements should not be overlooked—divalent cations (Mg²⁺ or Mn²⁺ at 1-5 mM) often enhance activity. Assay detection limits can be improved by optimizing substrate concentrations, extended incubation times for slow reactions, and using more sensitive detection methods. Systematic testing of these parameters using a factorial experimental design will efficiently identify optimal conditions for consistent enzymatic activity.

What insights can C. violaceum lnt provide about the evolution of bacterial lipoprotein processing?

The Apolipoprotein N-acyltransferase (lnt) from Chromobacterium violaceum provides valuable insights into the evolution of bacterial lipoprotein processing systems. Phylogenetic analysis positions C. violaceum lnt within the betaproteobacterial clade, showing characteristic sequence features that distinguish it from alphaproteobacterial and gammaproteobacterial homologs. The protein's 516-amino acid sequence contains highly conserved catalytic residues that have been maintained through evolutionary time, reflecting the essential nature of the N-acylation reaction in Gram-negative bacteria. Domain architecture analysis reveals the preservation of membrane-spanning regions and catalytic domains across diverse bacterial phyla, suggesting strong selective pressure to maintain functional lnt proteins. The C. violaceum lnt gene context (genomic neighborhood) differs somewhat from that of model organisms like E. coli, potentially indicating lineage-specific adaptations in regulation or functional coupling with other cellular processes. Particularly intriguing is the potential co-evolution of lnt with C. violaceum's secondary metabolite production systems, including violacein biosynthesis , suggesting possible integration of lipoprotein processing with specialized metabolic pathways. This evolutionary relationship provides a window into how essential cellular processes like lipoprotein maturation have been maintained while allowing adaptation to diverse ecological niches.

What emerging technologies could advance structural studies of C. violaceum lnt?

Several cutting-edge technologies show particular promise for advancing structural studies of Chromobacterium violaceum Apolipoprotein N-acyltransferase. Cryo-electron microscopy (cryo-EM) has revolutionized membrane protein structural biology, with recent advances in direct electron detectors and image processing algorithms enabling near-atomic resolution of smaller membrane proteins. Application to C. violaceum lnt would likely require reconstitution in nanodiscs or amphipols to provide a stable membrane-mimetic environment. Integrative structural biology approaches, combining cryo-EM with mass spectrometry and computational modeling, could overcome size limitations and conformational heterogeneity challenges. MicroED (microcrystal electron diffraction) represents another emerging technology for determining structures from microcrystals too small for traditional X-ray crystallography. Serial femtosecond crystallography using X-ray free-electron lasers (XFELs) allows data collection from microcrystals at room temperature, potentially capturing physiologically relevant conformational states. Single-particle cryo-EM tomography could visualize lnt in its native membrane environment, providing insights into its spatial organization. AlphaFold2 and other AI-based structure prediction algorithms, particularly when optimized for membrane proteins, offer complementary computational approaches that could accelerate experimental structure determination by providing refined starting models.

How might research on C. violaceum lnt contribute to novel antimicrobial strategies?

Research on Chromobacterium violaceum Apolipoprotein N-acyltransferase has significant potential to inform novel antimicrobial strategies through multiple innovative approaches. As a key enzyme in bacterial lipoprotein processing, lnt represents a promising drug target with several advantageous features: it is essential in many Gram-negative bacteria, absent in eukaryotes (reducing toxicity concerns), and accessible from the periplasmic space (potentially bypassing outer membrane permeability barriers). Structure-based drug design targeting the unique catalytic site of C. violaceum lnt could yield inhibitors with broad-spectrum activity against related enzymes in pathogenic bacteria. Detailed understanding of lnt's role in membrane integrity and stress responses could reveal synergistic combinations with existing antibiotics, particularly those targeting cell envelope processes. The connection between lnt and antibiotic-induced response pathways in C. violaceum suggests potential strategies to disrupt bacterial adaptation to antibiotic stress. The relationship between lipoprotein processing and violacein production points to possible approaches for manipulating bacterial secondary metabolite production through lnt modulation. Additionally, lnt's importance in presenting lipoproteins at the bacterial surface makes it relevant for vaccine development strategies targeting surface-exposed bacterial antigens. These multiple angles demonstrate how fundamental research on C. violaceum lnt could translate into diverse antimicrobial applications addressing the critical need for new treatment approaches.

What are the most effective methods for analyzing lnt-dependent lipoprotein modifications in C. violaceum?

Analysis of lnt-dependent lipoprotein modifications in Chromobacterium violaceum requires specialized techniques that can differentiate between processing intermediates and fully mature lipoproteins. Mass spectrometry-based approaches provide the highest resolution for characterizing these modifications. MALDI-TOF MS analysis of purified lipoproteins can distinguish between diacylated (lnt-independent) and triacylated (lnt-dependent) forms based on precise mass differences. For comprehensive profiling, liquid chromatography coupled with tandem mass spectrometry (LC-MS/MS) following tryptic digestion allows identification of specific modification sites and acyl chain compositions. Metabolic labeling using azide-modified fatty acids, followed by click chemistry-based detection, enables selective visualization of N-acylated lipoproteins in vivo. Gel-based approaches combining metabolic labeling with 2D gel electrophoresis provide global profiling of the lipoproteome. For functional analysis, selective chemical labeling of surface-exposed lipoproteins using membrane-impermeable biotinylation reagents, followed by affinity purification and identification, reveals which lipoproteins require lnt processing for proper localization. These techniques can be complemented by genetic approaches, comparing wild-type C. violaceum with lnt deletion or conditional mutants to identify proteins whose localization or function depends on N-acylation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.