Recombinant Chromobacterium violaceum Aquaporin Z (aqpZ)

Shipped with Ice Packs
In Stock

Description

Functional Role and Mechanism

  • Osmotic Regulation: Enables rapid water flux to counteract osmotic gradients, critical for survival in fluctuating environments .

  • Low Activation Energy: Water transport exhibits an activation energy of ~3.8 kcal/mol, indicative of a channel-mediated mechanism rather than transporter-like kinetics .

  • Substrate Specificity: Exclusively conducts water; no permeability to glycerol or urea, unlike some aquaporin homologs .

Biotechnological and Research Applications

  • Model for Membrane Protein Assembly: Recombinant AqpZ serves as a template for studying multimeric membrane protein folding and crystallization .

  • Cross-Reactivity Studies: Structural homology with human Aqp4 raises interest in autoimmune research, particularly for neuromyelitis optica .

  • Industrial Potential: High-yield solubilization methods (e.g., n-dodecyl-β-D-maltopyranoside) developed for E. coli AqpZ could streamline production of C. violaceum AqpZ for water-purification technologies .

Current Research Gaps and Future Directions

  • Structural Data: No high-resolution structures of C. violaceum AqpZ exist; cryo-EM or X-ray crystallography studies are needed.

  • Pathogenic Links: While C. violaceum is occasionally pathogenic, AqpZ’s role in host interactions remains unexplored .

  • Signal Transduction: Potential crosstalk between AqpZ and quorum-sensing systems in C. violaceum warrants investigation .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare your order accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Please note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple use to prevent repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
aqpZ; CV_2864; Aquaporin Z
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)
Target Names
Target Protein Sequence
MKSYGAEFLGTFWLVLGGCGSAVLAAGFPNLGIGFAGVALAFGLTVVTMAYAIGHISGCHLNPAVSIGLWAGGRFPAGQLAPYIVAQVLGAIAAGAVLYVIASGGAGFDVAKGFASNGYAEHSPGGYSLLAALVCEVVMTMFFLLVIMGATDKRAPAGFAPLAIGLALTLIHLISIPVTNTSVNPARSTGVALFVGGWAVQQLWLFWLAPIIGAVLGAKVYRLIAGESE
Uniprot No.

Target Background

Function
Aquaporin Z (aqpZ) is a channel that facilitates the osmotically driven movement of water in both directions. It plays a crucial role in osmoregulation and maintaining cell turgor during volume expansion in rapidly growing cells. AqpZ mediates the rapid entry or exit of water in response to sudden changes in osmolarity.
Database Links

KEGG: cvi:CV_2864

STRING: 243365.CV_2864

Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Aquaporin Z and why is it significant in Chromobacterium violaceum research?

Aquaporin Z (AqpZ) is a water channel protein belonging to the transmembrane protein family that facilitates the movement of water across cell membranes. It is ubiquitous in nature, including in bacteria like Chromobacterium violaceum. AqpZ is significant in C. violaceum research because understanding water transport mechanisms in this environmental pathogen provides insights into its adaptation and survival strategies. While the role of zinc transporters like ZnuABC has been well-characterized in C. violaceum virulence, the specific functions of water channels like AqpZ remain areas requiring further investigation for comprehensive understanding of this bacterium's physiology .

How does AqpZ function at the molecular level in bacterial systems?

At the molecular level, AqpZ functions through fast collective motions of its backbone structure that are critical to water transfer across the membrane. Solid-state nuclear magnetic resonance (ssNMR) studies reveal that the dominant motion timescale of most residues within the helices is distributed between 30 and 90 ns, suggesting correlated or collective motion characteristics between residues . Most residues in α-helices exhibit 15N-R1ρ values ranging from 3 to 8 s−1 with low uncertainties, while residues in loops or at the termini of helices show higher variability . This collective movement of the protein backbone creates a pathway that allows for efficient water molecule transport while maintaining selectivity against ions and other solutes. Understanding these molecular movements is crucial for characterizing how bacterial AqpZ functions in different environments.

What is the relationship between Chromobacterium violaceum pathogenicity and membrane proteins like AqpZ?

While direct evidence linking AqpZ to Chromobacterium violaceum pathogenicity is not fully established, research on other membrane proteins provides valuable context. C. violaceum is an environmental opportunistic pathogen that causes life-threatening infections with mortality rates of 35-53% . Membrane proteins play critical roles in bacterial pathogenicity, as demonstrated by zinc transporters like ZnuABC, which are essential for C. violaceum virulence by overcoming host-imposed zinc limitation . By analogy, water channel proteins like AqpZ may contribute to pathogenicity by enabling adaptation to osmotic stress conditions encountered during host infection. Methodologically, generating knockout mutants of aqpZ genes and evaluating their virulence in infection models, similar to studies done with znuCBA genes, would help establish whether AqpZ contributes to the pathogenic potential of C. violaceum .

What are the optimal conditions for expressing recombinant AqpZ from C. violaceum in E. coli systems?

For optimal expression of recombinant AqpZ in E. coli systems, researchers should consider the following protocol based on successful expression of similar aquaporins: Use E. coli BL21(DE3) as the expression host with a suitable expression vector containing the AqpZ gene from C. violaceum. The optimal induction conditions include 0.5 mM IPTG with incubation at 25°C for 20 hours . Lower temperatures during induction help prevent formation of inclusion bodies while maximizing protein yield. It's important to note that these conditions are derived from successful expression of AqpZ from Pseudomonas sp. and may require optimization for C. violaceum AqpZ. Researchers should conduct small-scale expression trials varying IPTG concentration (0.1-1.0 mM), temperature (16-30°C), and induction time (4-24 hours) to determine the best conditions for their specific construct .

What detergents are most effective for solubilizing AqpZ while maintaining its functional integrity?

Based on research with similar aquaporins, zwitterionic mild detergents like [(3-cholamidopropyl) dimethylammonio]-1-propanesulfonate (CHAPS) are particularly suitable for AqpZ solubilization . This detergent effectively extracts the protein from membranes while preserving its native structure and function. The methodological approach should involve:

  • Preparing cell lysates in buffer containing protease inhibitors

  • Solubilizing membrane fractions with CHAPS at concentrations between 0.5-2%

  • Incubating the mixture at 4°C with gentle agitation for 1-3 hours

  • Removing insoluble material by centrifugation at >100,000×g

Researchers should evaluate alternative detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) if CHAPS proves suboptimal. Each preparation should be assessed for protein yield, purity, and most importantly, functional activity through water transport assays to ensure the solubilization process has not compromised the protein's integrity .

What purification strategy yields the highest purity and activity for recombinant C. violaceum AqpZ?

A multi-step purification strategy is recommended for obtaining high-purity, active recombinant C. violaceum AqpZ:

  • Affinity Chromatography: Use histidine-tagged constructs purified via Ni-NTA or similar matrices as the initial capture step . Wash extensively with low concentrations of imidazole (10-20 mM) to remove non-specifically bound proteins before elution with 250-300 mM imidazole.

  • Size Exclusion Chromatography: Further purify the affinity-purified protein using size exclusion chromatography to separate properly folded tetrameric AqpZ from aggregates and impurities.

  • Quality Control: Assess protein purity using SDS-PAGE and Western blotting. Confirm the tetrameric assembly using native PAGE or analytical size exclusion chromatography.

  • Functional Verification: Reconstitute purified AqpZ into liposomes and measure water transport activity using stopped-flow light scattering or other water permeability assays to confirm functionality.

This strategy typically yields protein with >95% purity that retains its water channel activity. Throughout purification, maintain the detergent concentration above its critical micelle concentration to prevent protein aggregation .

How can researchers effectively measure water transport activity of recombinant AqpZ?

To effectively measure water transport activity of recombinant AqpZ, researchers should reconstitute the purified protein into liposomes and utilize the following methodological approaches:

  • Liposome Preparation: Create proteoliposomes by incorporating purified AqpZ into liposomes composed of E. coli lipid extracts or synthetic lipids like POPC (1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine) at protein-to-lipid ratios between 1:50 and 1:200.

  • Dynamic Light Scattering (DLS): Characterize the size distribution of liposomes and proteoliposomes using DLS. This step confirms successful reconstitution and provides the size parameters needed for permeability calculations .

  • Stopped-Flow Spectroscopy: Subject proteoliposomes to an osmotic gradient in a stopped-flow apparatus and monitor the rate of vesicle shrinkage or swelling via light scattering. The rate of change in light scattering correlates with water permeability.

  • Calculation of Permeability Coefficients: Calculate osmotic water permeability coefficients (Pf) using the equation:

    Pf=kV0SVwΔosmP_f = \frac{k \cdot V_0}{S \cdot V_w \cdot \Delta \text{osm}}

    where k is the rate constant of vesicle volume change, V₀ is the initial vesicle volume, S is the vesicle surface area, Vw is the molar volume of water, and Δosm is the osmotic gradient.

  • Inhibitor Studies: Validate channel-specific water transport by using AqpZ inhibitors like mercury compounds and measuring the reduction in permeability.

Compare water transport rates between proteoliposomes containing AqpZ and control liposomes without protein to quantify the contribution of AqpZ to membrane water permeability .

What techniques are most informative for analyzing the structural dynamics of AqpZ?

The most informative techniques for analyzing structural dynamics of AqpZ include:

  • Solid-State Nuclear Magnetic Resonance (ssNMR): This technique provides atomic-level insights into protein dynamics. 3D DIPSHIFT experiments can measure 1Hα-13Cα dipolar coupling-based order parameters to assess backbone rigidity . 15N-R1 and 15N-R1ρ relaxation measurements reveal motion timescales ranging from nanoseconds to milliseconds .

  • Molecular Dynamics (MD) Simulations: Complement experimental data with MD simulations to identify collective motion modes within the AqpZ structure and correlate them with water transport function.

  • X-ray Crystallography: Determine high-resolution static structures that serve as frameworks for understanding dynamic properties. Multiple structures under different conditions can capture conformational states.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Measure the rate of backbone amide hydrogen exchange with deuterium to identify regions of varying flexibility and solvent accessibility.

  • Electron Paramagnetic Resonance (EPR) Spectroscopy: With site-directed spin labeling, EPR can measure distances between residues and their changes during function.

The integration of these techniques provides comprehensive insights into how fast collective motions of the AqpZ backbone (particularly within the 30-90 ns timescale) contribute to water transport mechanisms . Analysis should focus on both the water-conducting pore and the surrounding helical structures to understand how protein dynamics facilitate selective water permeation.

How does temperature affect AqpZ structure and function, particularly in psychrophilic adaptations?

Temperature significantly impacts AqpZ structure and function, with psychrophilic (cold-adapted) AqpZ variants showing distinct adaptations:

  • Structural Flexibility: Psychrophilic AqpZ proteins typically exhibit increased structural flexibility at low temperatures compared to mesophilic counterparts. This flexibility allows for maintained catalytic efficiency at lower temperatures where proteins typically become more rigid .

  • Amino Acid Composition: Cold-adapted AqpZ shows characteristic changes in amino acid composition, including:

    • Decreased arginine and proline content, which reduces structural rigidity

    • Increased glycine and small hydrophobic residues that enhance local flexibility

    • Modified surface charge distribution that affects hydration and stability

  • Temperature-Activity Relationship: Researchers should assess water transport activity across a temperature range (0-40°C) using the stopped-flow technique described previously. Psychrophilic AqpZ typically shows higher relative activity at low temperatures (0-15°C) compared to mesophilic variants .

  • Thermostability Analysis: Differential scanning calorimetry (DSC) or circular dichroism (CD) with thermal ramping can determine the thermal stability profile of AqpZ. Psychrophilic variants typically show lower melting temperatures and denaturation enthalpies.

These adaptations enable psychrophilic microorganisms like cold-adapted Pseudomonas sp. to maintain water homeostasis in low-temperature environments. Understanding these adaptations provides insights for potential applications in cold-environment technologies and molecular engineering of temperature-tolerant membrane proteins .

How does C. violaceum AqpZ differ from other bacterial aquaporins in structure and function?

Comparing C. violaceum AqpZ with other bacterial aquaporins reveals several important structural and functional differences:

FeatureC. violaceum AqpZ (predicted)E. coli AqpZPseudomonas AqpZOther Bacterial Aquaporins
Channel SelectivityLikely highly selective for waterHighly selective for waterWater-selective with psychrophilic adaptationsVariable; some permit glycerol transport
Oligomeric StatePredicted tetramericTetramericTetramericTypically tetrameric; some trimeric
Regulatory MechanismsUnknown, possibly zinc-responsiveOsmotic stress responsiveTemperature responsiveVarious environmental signals
Backbone DynamicsPredicted similar to other AqpZ proteinsFast collective motions critical for functionEnhanced flexibility in cold conditionsVariable motion timescales
Temperature AdaptationUnknown, likely mesophilicMesophilicPsychrophilicSpecies-dependent

While specific experimental data for C. violaceum AqpZ is limited, comparison with the collective motions observed in other bacterial aquaporins (30-90 ns timescale) suggests similar backbone dynamics may be critical for water transport function . The association with zinc homeostasis systems in C. violaceum raises interesting possibilities for regulatory mechanisms that may differ from other bacterial species . Methodologically, researchers should employ comparative genomics and structural modeling alongside experimental validation to fully characterize these differences.

What is the potential role of AqpZ in C. violaceum's adaptation to environmental stressors?

AqpZ likely plays several critical roles in C. violaceum's adaptation to environmental stressors:

  • Osmotic Stress Response: AqpZ may facilitate rapid water influx or efflux in response to changing osmotic conditions in C. violaceum's diverse habitats (soil, water bodies). This enables the bacterium to maintain cellular volume and function during environmental transitions.

  • Biofilm Formation: Given that the deletion of znuCBA in C. violaceum reduced biofilm formation under zinc limitation , AqpZ might similarly contribute to biofilm development by regulating water content and flow within the biofilm matrix. Methodologically, researchers should compare biofilm formation between wild-type and aqpZ-deletion mutants under various stress conditions.

  • Temperature Adaptation: Based on insights from psychrophilic AqpZ variants, C. violaceum AqpZ may exhibit structural adaptations that maintain functionality across the temperature range of its habitats . Temperature-dependent water transport assays can elucidate this adaptation.

  • Nutrient Limitation Response: Similar to how ZnuABC helps C. violaceum overcome zinc limitation , AqpZ may be regulated in response to specific nutrient stresses to maintain cellular homeostasis.

  • Virulence and Host Interaction: During infection, C. violaceum encounters host defense mechanisms including oxidative stress and antimicrobial peptides. AqpZ might contribute to stress tolerance by regulating cellular water content under these conditions.

These potential roles warrant investigation through gene expression studies under various stressors, phenotypic characterization of aqpZ mutants, and in vivo infection models comparing wild-type and aqpZ-deficient strains .

How might researchers leverage recombinant AqpZ for biotechnological applications?

Researchers can leverage recombinant C. violaceum AqpZ for several innovative biotechnological applications:

  • Biomimetic Water Filtration Membranes: Incorporate purified AqpZ into synthetic membrane materials to create highly efficient water filtration systems with selective permeability . This approach requires:

    • Optimizing AqpZ stability in artificial membranes

    • Developing methods for uniform protein orientation

    • Creating scalable manufacturing protocols

  • Biosensors for Environmental Monitoring: Develop AqpZ-based biosensors that detect changes in water quality, contaminants, or specific inhibitory compounds through altered water transport function.

  • Cell-Based Environmental Stress Models: Engineer reporter systems in which AqpZ activity is coupled to detectable signals, creating cellular biosensors for environmental stressors.

  • Pharmaceutical Screening Platforms: Use proteoliposomes containing AqpZ to screen for compounds that modulate water channel activity, potentially identifying novel therapeutics for water-balance disorders.

  • Cold-Active Enzyme Technology: If C. violaceum AqpZ shows psychrophilic characteristics like Pseudomonas AqpZ , it could be valuable for cold-environment applications including:

    • Low-temperature bioremediation systems

    • Cold-storage preservation technologies

    • Winter-hardy engineered organisms

Methodologically, researchers should focus on optimizing expression and purification protocols for high yields, developing robust activity assays, and creating standardized reconstitution systems that maintain long-term stability for commercial applications .

How might AqpZ function intersect with zinc homeostasis mechanisms in C. violaceum?

The potential intersection between AqpZ function and zinc homeostasis in C. violaceum represents an intriguing area for advanced investigation:

  • Co-regulation Mechanisms: The Zur regulator that controls znuCBA expression in C. violaceum might also influence aqpZ expression. Transcriptomic analysis comparing wild-type and Δzur mutants could reveal whether aqpZ is co-regulated with zinc uptake systems.

  • Functional Coupling: Zinc limitation affects multiple physiological processes in C. violaceum, including violacein production, motility, and biofilm formation . These processes also require proper water homeostasis, suggesting potential functional coupling between AqpZ and ZnuABC systems.

  • Zinc as a Structural Element: Zinc ions often play structural roles in membrane proteins. Researchers should investigate whether AqpZ contains zinc-binding motifs that influence its folding, stability, or function through:

    • Bioinformatic analysis of metal-binding sites

    • Differential activity assays with varied zinc concentrations

    • Structural studies with and without zinc

  • Competitive Stress Responses: During interspecies competition or host infection, C. violaceum faces both zinc limitation and osmotic challenges . The integrated response to these stressors likely involves coordinated regulation of both zinc transporters and water channels.

Methodologically, researchers should employ zinc-chelated growth conditions similar to those used in ZnuABC studies (EDTA or calprotectin treatment) , combined with water stress conditions, to observe the integrated response of both systems and identify potential regulatory cross-talk.

What methodological challenges must be overcome when studying AqpZ in the context of C. violaceum pathogenesis?

Researchers face several methodological challenges when studying AqpZ in C. violaceum pathogenesis:

  • Genetic Manipulation Complexity: C. violaceum has high intrinsic antibiotic resistance , limiting selection markers for genetic modifications. Researchers should:

    • Optimize transformation protocols specifically for C. violaceum

    • Employ CRISPR-Cas9 systems adapted for C. violaceum

    • Develop marker-free deletion systems

  • Host-Relevant Expression Conditions: Identifying conditions that mimic host environments where AqpZ function is critical requires:

    • Developing cell culture infection models that permit monitoring of aqpZ expression

    • Creating reporter systems that function during infection

    • Establishing ex vivo tissue models for studying pathogen-host interactions

  • Distinguishing AqpZ-Specific Effects: C. violaceum may have multiple aquaporins or water transport mechanisms. Researchers must:

    • Conduct comprehensive genomic analysis to identify all potential aquaporins

    • Generate specific antibodies or tagged constructs to track individual proteins

    • Create combinatorial knockout strains to assess functional redundancy

  • In Vivo Relevance Assessment: Connecting in vitro findings to pathogenesis requires:

    • Developing suitable animal models that recapitulate human infections

    • Establishing infection protocols that allow tracking of bacterial gene expression

    • Creating methods to monitor water flux in infection microenvironments

  • Integration with Virulence Mechanisms: Understanding how AqpZ interacts with established virulence factors like the Cpi1 type III secretion system requires:

    • Co-immunoprecipitation or proximity labeling studies

    • Transcriptional profiling of AqpZ-deficient strains

    • Phenotypic characterization of double mutants

These challenges necessitate multidisciplinary approaches combining molecular microbiology, structural biology, and infection models to fully elucidate AqpZ's role in pathogenesis .

How do the fast collective motions of AqpZ backbone contribute to selectivity and efficiency of water transport?

The fast collective motions of AqpZ backbone represent a sophisticated mechanism for balancing transport efficiency with selectivity:

  • Coordinated Channel Dynamics: The collective motions occurring on the 30-90 ns timescale create coordinated movements throughout the water-conducting channel. These motions:

    • Facilitate water molecule passage in a directional manner

    • Prevent passage of ions and other solutes through size exclusion and electrostatic mechanisms

    • Create transient hydrogen bonding networks that guide water molecules

  • Selectivity Filter Dynamics: The NPA (asparagine-proline-alanine) motifs and aromatic/arginine (ar/R) constriction regions in AqpZ undergo subtle but critical backbone motions that:

    • Maintain precise pore dimensions that exclude larger molecules

    • Preserve electrostatic environments that repel charged ions

    • Create a dipole reorientation mechanism that breaks hydrogen bond networks between water molecules

  • Energetic Considerations: The collective motions influence the energetics of water transport by:

    • Reducing the energy barrier for water passage

    • Creating a coordinated pathway that minimizes entropy loss

    • Establishing a precise balance between protein-water and water-water interactions

  • Methodological Investigation Approaches: Researchers can further investigate these dynamics through:

    • Site-directed mutagenesis targeting residues involved in collective motions

    • Advanced MD simulations incorporating quantum mechanics for hydrogen bonding networks

    • Time-resolved spectroscopic methods to capture transient states

The 3D Gaussian Axial Fluctuation (GAF) model analysis reveals that these collective motions represent the dominant modes of movement within AqpZ , suggesting evolutionary optimization for efficient yet selective water transport. Understanding these dynamics may inform the design of biomimetic water filtration systems with enhanced efficiency and selectivity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.