Recombinant Chromobacterium violaceum ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your convenience.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; CV_0666; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)
Target Names
atpB
Target Protein Sequence
MASNATDYIKHHLTFWNSDPSAGFWSLHVDTFSISLVLGFLFAAVFAMVARRASIEAPGR LQLFVEMIVELVQTQVREVFHGKSKMIAPLALTIFCWVFLMNFMDLFPVDLFPMAAQWIG YTFFGLEPHHVYFRVVPSADVNATFAMSLSVLILIVGFSIKAKGLGGWGKELLTAPFHSS NPVGAIILAPLNFAFQLVELAAKPISLSLRLFGNLYAGELIFILIALLPWGLQWVLGAPW AIFHILIITLQAFVFMMLTIVYLSLAVEAH
Uniprot No.

Target Background

Function
As a key component of the proton channel, this protein plays a direct role in the translocation of protons across the membrane.
Database Links

KEGG: cvi:CV_0666

STRING: 243365.CV_0666

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of ATP synthase in Chromobacterium violaceum?

Chromobacterium violaceum possesses an F₀F₁-type ATP synthase similar to that found in Escherichia coli. The enzyme consists of two primary functional domains: F₁, which contains the catalytic sites for ATP synthesis, and F₀, which forms the membrane-embedded proton channel. The subunit a (atpB) is a critical component of the F₀ domain, participating in proton translocation across the membrane. The complete ATP synthase complex functions as a rotary nanomotor, utilizing the energy from proton electrochemical gradient to synthesize ATP .

The general assembly of ATP synthase involves multiple intermediate complexes. In bacterial systems like C. violaceum, assembly begins with the formation of the c-ring, followed by binding of the F₁ sector, integration of the stator arm, and finally the incorporation of subunits a (atpB) and other membrane-bound components .

How does the ATP synthase in C. violaceum contribute to its metabolic versatility?

C. violaceum demonstrates remarkable metabolic flexibility, being able to survive in both aerobic and anaerobic conditions. Its ATP synthase plays a pivotal role in this versatility by efficiently coupling proton transport with ATP production. Based on comparative analysis with other bacteria, C. violaceum possesses six enzymes involved in energy metabolism, whereas related bacteria lack one to four of these enzymes .

The ability of C. violaceum to adapt to various environmental conditions is reflected in the following enzyme distribution comparison:

EnzymeChromobacterium violaceumPseudomonas aeruginosaRalstonia solanarumEscherichia coliNeisseria meningitidisXylella fastidiosa
Sox-type cytochrome oxidase++++-+
FixN-type cytochrome oxidase+++-+-
Cytochrome bd oxidase++++--
Nitrate reductase++++--

This enzymatic diversity enables C. violaceum to generate ATP through multiple pathways depending on oxygen availability and environmental conditions .

What are the optimal expression systems for producing recombinant C. violaceum atpB protein?

When expressing recombinant C. violaceum atpB, researchers should consider multiple expression systems based on the specific experimental objectives:

Expression vectors incorporating a mild promoter (such as tac or T7lac with reduced inducer concentration) typically provide better results than strong constitutive promoters, which can lead to toxicity. Fusion tags such as His₆ or Strep-tag II facilitate purification while causing minimal interference with protein function.

For functional studies, consider using C. violaceum-derived expression systems or other Gram-negative hosts that provide the appropriate membrane environment for proper folding. Cell-free expression systems represent an alternative approach that can circumvent toxicity issues associated with membrane protein overexpression .

What purification strategies yield functionally active recombinant atpB protein?

Purification of functionally active recombinant atpB requires specialized approaches due to its hydrophobic nature and membrane integration:

  • Membrane preparation: After expression, prepare membrane fractions through differential centrifugation (typically 150,000-200,000 × g for 1 hour).

  • Detergent solubilization: Screen multiple detergents for optimal extraction; n-dodecyl-β-D-maltoside (DDM) at 1-2% often provides a good balance between extraction efficiency and retention of native structure.

  • Affinity chromatography: Utilize fusion tags (His₆ or Strep-tag II) for initial purification, with detergent concentration maintained above critical micelle concentration throughout.

  • Size exclusion chromatography: Perform as a polishing step to separate monomeric atpB from aggregates and other contaminants.

  • Reconstitution: For functional studies, reconstitute purified atpB into proteoliposomes using E. coli polar lipids or synthetic lipid mixtures that mimic the bacterial membrane composition.

Activity assessment using proton translocation assays with pH-sensitive fluorescent dyes (such as ACMA) can confirm functional integrity of the purified protein .

How can researchers verify proper folding and membrane integration of recombinant atpB?

Verification of proper folding and membrane integration of recombinant atpB should employ multiple complementary techniques:

Circular dichroism (CD) spectroscopy provides information about secondary structure content, with properly folded atpB showing characteristic α-helical signatures (negative bands at 208 and 222 nm).

Limited proteolysis followed by mass spectrometry can identify exposed regions versus protected transmembrane domains, providing a topological map of the protein's membrane integration.

Fluorescence-based thermal shift assays using environment-sensitive dyes (such as SYPRO Orange) can assess protein stability and detect detergent-dependent folding changes.

The gold standard for functional verification involves reconstitution into proteoliposomes followed by proton translocation assays. Researchers should observe ATP-dependent proton pumping or proton gradient-driven ATP synthesis depending on the experimental setup .

How should researchers address the high hydrophobicity of atpB when analyzing mass spectrometry data?

The high hydrophobicity of atpB presents several challenges for mass spectrometry analysis that require specific methodological adjustments:

Implement specialized extraction protocols using stronger solubilization agents like 60-80% formic acid or hexafluoroisopropanol for complete dissolution before tryptic digestion. Consider alternative proteases to trypsin, such as chymotrypsin or Asp-N, which may provide better coverage of hydrophobic regions.

For data analysis, employ search algorithms optimized for membrane proteins (such as MSFragger with membrane protein-specific parameters) and lower the peptide confidence thresholds for hydrophobic regions while implementing additional validation steps.

To improve peptide detection, researchers should consider chemical modifications that increase the hydrophilicity of membrane-spanning peptides, such as selective derivatization of free amino groups with hydrophilic reagents before MS analysis.

When interpreting results, account for the typically lower sequence coverage compared to soluble proteins. Coverage of 60-70% should be considered acceptable for highly hydrophobic membrane proteins like atpB .

What are the common pitfalls in interpreting functional data from ATP synthase reconstitution experiments?

When interpreting functional data from ATP synthase reconstitution experiments involving recombinant atpB, researchers should be aware of several potential pitfalls:

Incomplete incorporation of atpB into proteoliposomes can lead to underestimation of activity. Verify incorporation efficiency through sucrose gradient centrifugation or antibody-based quantification of incorporated protein.

Random orientation of reconstituted atpB results in bidirectional proton translocation, potentially masking directional activity. Use membrane-impermeable inhibitors or pH gradients to differentiate between correctly and incorrectly oriented protein populations.

Background proton leakage across liposomal membranes can confound measurements of atpB-specific activity. Include proper controls with protein-free liposomes and establish baseline leakage rates for each experimental condition.

The activity of reconstituted atpB is highly dependent on lipid composition and protein-to-lipid ratio. Systematically optimize these parameters and clearly report them to enable reproducibility across different laboratories .

How can researchers differentiate between effects of atpB mutations on protein stability versus catalytic function?

Distinguishing between stability and functional effects of atpB mutations requires a multi-faceted experimental approach:

First, assess protein expression and membrane integration through quantitative Western blotting of membrane fractions versus total cell extracts. A significant reduction in membrane-associated mutant protein compared to wild-type suggests stability or targeting defects.

Next, evaluate thermal stability using differential scanning calorimetry or fluorescence-based thermal shift assays on purified protein. Shifts in melting temperature directly indicate altered protein stability independent of function.

For functional assessment, reconstitute normalized amounts of properly folded protein (based on stability studies) into proteoliposomes and measure proton translocation rates. Decreased activity with properly folded and membrane-integrated protein indicates specific catalytic defects.

How might studying C. violaceum ATP synthase inform therapeutic strategies against this pathogen?

C. violaceum can cause fatal septicemia in humans and animals, with limited treatment options available. Advanced study of its ATP synthase, particularly atpB, offers several potential therapeutic avenues:

The unique aspects of bacterial ATP synthase compared to human homologs provide opportunities for selective targeting. Structural studies of recombinant atpB could reveal unique binding pockets for small molecule inhibitors that specifically disrupt proton translocation in C. violaceum without affecting human ATP synthase.

ATP synthase inhibition represents a particularly promising approach against C. violaceum due to its metabolic versatility. Unlike some bacterial pathogens that can bypass oxidative phosphorylation under certain conditions, C. violaceum relies heavily on its ATP synthase across diverse environmental conditions, suggesting that ATP synthase inhibitors might be effective regardless of infection site microenvironment .

Researchers should focus on identifying compounds that specifically bind to unique regions of C. violaceum atpB, potentially disrupting its assembly into the ATP synthase complex or interfering with the conformational changes required for proton translocation .

What role might atpB play in the environmental adaptability of C. violaceum?

C. violaceum demonstrates remarkable environmental adaptability, thriving in diverse conditions, and atpB likely plays a crucial role in this versatility:

The proton-translocating function of atpB is fundamental to energy production across varying oxygen conditions. Its efficient coupling to the ATP synthase complex enables C. violaceum to maintain energy production in both aerobic and anaerobic environments, contributing to its ecological success.

Comparative analysis shows that C. violaceum possesses a complete set of energy metabolism enzymes that many related bacteria lack. The ATP synthase complex, with atpB as a key component, serves as the final common pathway for converting the proton gradient into ATP regardless of the upstream respiratory chain components utilized .

Future research should investigate potential regulatory mechanisms affecting atpB expression or function under different environmental conditions. Particularly valuable would be studies examining whether C. violaceum modifies the structure or composition of its ATP synthase complex to optimize function across varying pH, temperature, or oxygen conditions .

How does the integration of atpB into the ATP synthase complex compare between C. violaceum and other bacterial species?

The integration of atpB into the ATP synthase complex involves a sophisticated assembly process that may differ between bacterial species:

While the general F₀F₁ ATP synthase architecture is conserved across bacteria, the assembly pathway shows species-specific variations. In model systems, assembly occurs through distinct modules: the c-ring, F₁, and the peripheral stalk. The addition of atpB (subunit a) typically represents one of the final steps in complex assembly .

Current evidence suggests that in many bacteria, including C. violaceum, ATP synthase can assemble into a complex lacking only atpB and A6L (another membrane subunit), forming a structure of approximately 550 kDa (compared to the complete 597 kDa complex). This suggests that atpB incorporation is not required for the assembly of other components .

The final addition of atpB to the complex may be translationally regulated by the presence of other ATP synthase components, enabling balanced production of nuclear and mitochondrial/bacterial-encoded subunits. Research into the specific chaperones and assembly factors that facilitate atpB incorporation in C. violaceum would advance understanding of ATP synthase biogenesis in this organism .

Advanced structural biology techniques, including cryo-electron microscopy of partially assembled complexes, could elucidate the specific interactions that stabilize atpB within the C. violaceum ATP synthase complex and identify potential species-specific features that might be exploited for targeted therapeutics .

What are the optimal approaches for creating site-directed mutations in C. violaceum atpB for structure-function studies?

For successful site-directed mutagenesis studies of C. violaceum atpB, researchers should implement a hierarchical experimental design:

Begin with computational prediction of critical residues by constructing homology models based on structurally characterized ATP synthase complexes. Focus on conserved charged residues in predicted transmembrane regions that likely participate in proton translocation.

Generate mutations using overlap extension PCR or commercial site-directed mutagenesis kits, but avoid introducing restriction sites that might alter the codon usage or introduce unwanted amino acid changes.

For expression analysis, utilize a dual-plasmid complementation system where the chromosomal atpB is deleted or conditionally suppressed, while mutant variants are expressed from a tunable promoter. This approach provides better control over expression levels than single-plasmid systems.

When analyzing mutants, implement a tiered functional assessment starting with growth phenotypes under different carbon sources, followed by membrane potential measurements, and finally direct measurement of ATP synthesis rates in inverted membrane vesicles .

How can researchers develop assays to screen for compounds that specifically target C. violaceum atpB?

Development of targeted screening assays for C. violaceum atpB requires multiple complementary approaches:

First, establish a primary screen using bacterial growth inhibition in media requiring oxidative phosphorylation (minimal media with non-fermentable carbon sources). Counter-screen against growth in fermentable carbon sources to identify compounds that specifically inhibit ATP synthase rather than causing general toxicity.

For target validation, develop a secondary biochemical assay using inverted membrane vesicles containing either wild-type or resistor-conferring mutants of atpB. Compounds that inhibit ATP synthesis in wild-type but not mutant preparations likely target atpB specifically.

Implement structure-based virtual screening using homology models of C. violaceum atpB to identify compounds predicted to bind unique pockets absent in human ATP synthase. Focus on regions involved in proton translocation or subunit interactions.

For compounds showing promise, confirm target engagement using thermal shift assays with purified atpB or competition binding assays with labeled probe compounds that bind known sites in the ATP synthase complex .

What approaches enable studying the interaction between atpB and other ATP synthase subunits?

Investigating subunit interactions within the ATP synthase complex requires specialized techniques due to the hydrophobic nature of many components:

Chemical cross-linking coupled with mass spectrometry provides valuable insights into subunit proximity and orientation. Using heterobifunctional cross-linkers with different spacer lengths can map the distance constraints between atpB and neighboring subunits.

For dynamic interactions, implement FRET-based approaches by introducing fluorescent protein tags or small molecule fluorophores at strategic positions on atpB and potential interaction partners. Monitor FRET efficiency changes during ATP synthesis or hydrolysis to capture conformational dynamics.

Mutagenesis-based interaction mapping through second-site suppressor screens can identify compensatory mutations that restore function when primary mutations disrupt subunit interactions. This approach is particularly powerful for identifying functional interaction interfaces.

For in vivo studies, employ bacterial two-hybrid systems adapted for membrane proteins, such as BACTH (Bacterial Adenylate Cyclase Two-Hybrid) system, to confirm direct interactions between atpB and other ATP synthase components in a cellular context .

How might the study of C. violaceum atpB contribute to understanding bacterial evolution and adaptation?

Studying C. violaceum atpB offers unique opportunities to understand evolutionary adaptations in bioenergetic systems:

C. violaceum possesses a complete set of energy metabolism enzymes that many related bacteria lack, suggesting evolutionary pressure to maintain metabolic versatility. Comparative sequence analysis of atpB across diverse bacterial species can reveal conservation patterns in proton-conducting pathways versus divergence in regulatory or assembly regions .

The ability of C. violaceum to thrive in both aerobic and anaerobic conditions likely required adaptations in its ATP synthase, particularly in the proton-conducting subunits like atpB. Investigating these adaptations could reveal how bacterial energy systems evolve to accommodate environmental flexibility.

Researcher should consider employing ancestral sequence reconstruction methods to recreate evolutionary intermediates of atpB, followed by functional characterization to understand the progressive acquisition of features that enable broader environmental tolerance .

What role might ATP synthase play in the virulence mechanisms of C. violaceum?

ATP synthase may represent an underexplored contributor to C. violaceum virulence through several potential mechanisms:

Energy production is critical for virulence factor synthesis and secretion. C. violaceum possesses two distinct type III secretion systems (T3SSs) that contribute significantly to its pathogenicity. These complex molecular machines require substantial energy input, potentially linking ATP synthase efficiency to virulence capacity .

The ability to maintain ATP production under varying host conditions (including oxygen limitation within abscesses or granulomas) likely contributes to C. violaceum's ability to cause systemic infections. Mutations affecting atpB function might therefore attenuate virulence by restricting metabolic flexibility within the host.

Research should explore whether host-derived factors directly impact ATP synthase function during infection. For example, neutrophil-derived reactive oxygen species might damage ATP synthase components, necessitating repair mechanisms for sustained virulence .

How does the ATP synthase of C. violaceum coordinate with other metabolic systems during environmental stress responses?

The coordination between ATP synthase and other metabolic systems represents a critical aspect of bacterial stress adaptation:

During environmental transitions, C. violaceum must balance electron transport chain activity with ATP synthase function to maintain appropriate proton motive force. Investigating how atpB expression and activity are regulated in response to changing oxygen availability could reveal important regulatory mechanisms.

Metabolomic studies comparing wild-type C. violaceum with atpB mutants under various stress conditions (pH, temperature, nutrient limitation) would help elucidate how energy metabolism adjusts to environmental challenges.

The interplay between ATP synthase and the violacein biosynthetic pathway deserves particular attention, as both systems are energetically demanding yet critical for different aspects of C. violaceum biology. The violacein pigment provides competitive advantages in ecological niches, but its production requires significant energy investment .

Researchers should investigate whether C. violaceum employs post-translational modifications of atpB or other ATP synthase components to rapidly adjust energy coupling efficiency in response to environmental stressors, potentially providing faster adaptation than transcriptional regulation alone .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.