Recombinant Chromobacterium violaceum Cobalamin biosynthesis protein CobD (cobD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have a specific format preference, please indicate it in your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on your location and purchasing method. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while the shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobD; CV_1575; Cobalamin biosynthesis protein CobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)
Target Names
cobD
Target Protein Sequence
MNSALFLPIALLLDRLLGEPPRWHPLVGFGRLVKAVERAAYPAAPGAEPVWRMRLRGAAA IALLLAPFTLAAWALARLPLLEIIVPVALLYLAVGARSLAQHAEVVRKALAEGDLQLARE RVGWIVSRDTRELDEAGVARATIESVLENGSDAVFAALFWFLVLGAPGAVLYRLANTLDA MWGYKNERYLHFGWAAARFDDMLNYLPARLTALTYLLLGHAAKGWRCWRTQAPTWYSPNA GPVMAAGAGALGVSLGGGARYHGQWKERPPLGCGPTPTHEDIGRAVRLVNRGMWLWAALS LAAAILIGAIHA
Uniprot No.

Target Background

Function
CobD catalyzes the conversion of cobyric acid to cobinamide by adding aminopropanol to the F carboxylic group.
Database Links

KEGG: cvi:CV_1575

STRING: 243365.CV_1575

Protein Families
CobD/CbiB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of CobD in cobalamin biosynthesis?

CobD functions as an L-threonine-O-3-phosphate decarboxylase in the cobalamin biosynthetic pathway. It catalyzes the conversion of L-threonine-O-3-phosphate to (R)-1-amino-2-propanol O-2-phosphate, which is a crucial step in the assembly of the aminopropanol side chain that connects the corrin ring to the nucleotide loop in the final cobalamin structure. This enzymatic activity represents one of the many steps involved in converting aminolevulinic acid via uroporphyrinogen III and adenosylcobyric acid to the final cobalamin forms used by enzymes in both producing organisms and other species, including humans .

How does CobD from Chromobacterium violaceum differ from CobD in other bacterial species?

The CobD protein from C. violaceum shares the core catalytic domains and conserved residues with CobD homologs from other bacteria, but exhibits species-specific sequence variations that may affect substrate specificity and catalytic efficiency. While the fundamental phosphate decarboxylase activity is preserved across species, C. violaceum CobD contains unique amino acid residues within its active site that might contribute to its adaptation to C. violaceum's specific metabolic environment. This distinction is particularly relevant when considering that C. violaceum has evolved regulatory mechanisms like the VioS repressor that affect various metabolic pathways, suggesting possible unique regulation of cobalamin biosynthesis as well .

What is the genomic context of the cobD gene in Chromobacterium violaceum?

In C. violaceum, the cobD gene is part of the cobalamin biosynthetic gene cluster. It is typically positioned among other cob genes that encode enzymes for various steps in the cobalamin pathway. Unlike the violacein operon, which is regulated by the CviI/R quorum sensing system and the VioS repressor, the cobalamin biosynthetic genes appear to follow different regulatory patterns . Understanding this genomic organization is essential for researchers investigating the coordinated expression of cobalamin biosynthesis proteins and potential regulatory elements affecting cobD expression in C. violaceum.

How do environmental factors influence the expression and activity of recombinant CobD in experimental systems?

The expression and activity of recombinant CobD are significantly influenced by oxygen availability, temperature, pH, and metal ion concentrations. Since cobalamin biosynthesis pathways differ between aerobic and anaerobic organisms - particularly in when cobalt is incorporated into the corrin ring structure - oxygen levels can substantially affect CobD expression and function . When expressing recombinant C. violaceum CobD, researchers should consider:

  • Oxygen regulation: Maintaining appropriate dissolved oxygen levels during cultivation

  • Temperature optimization: Typically 28-30°C for C. violaceum-derived proteins

  • pH monitoring: Maintaining pH 6.5-7.5 for optimal enzyme stability

  • Metal ion supplementation: Particularly cobalt ions needed for the pathway

Experimental designs should include controlled environmental conditions with real-time monitoring systems to ensure reproducible results when studying recombinant CobD activity.

What are the structural determinants of CobD substrate specificity and how can they be modified for enhanced catalytic efficiency?

The substrate specificity of CobD is determined by several structural elements:

  • Active site architecture: Contains conserved positively charged residues that coordinate with the phosphate group of L-threonine-O-3-phosphate

  • Binding pocket dimensions: Determines accommodation of substrate side chains

  • Catalytic residues: Typically include a lysine residue essential for the decarboxylation mechanism

Methodological approaches to modify these determinants include:

  • Site-directed mutagenesis targeting residues within 5Å of the substrate binding site

  • Rational design based on structural homology models or crystallographic data

  • Directed evolution using error-prone PCR followed by activity screening

  • Computer-aided protein design incorporating quantum mechanical simulations of the transition state

Researchers should implement a progressive mutation strategy, beginning with highly conserved residues and extending to those showing species-specific variations, followed by rigorous kinetic characterization using spectrophotometric assays or coupled enzyme systems to detect (R)-1-amino-2-propanol O-2-phosphate formation.

How does the interaction between CobD and other cobalamin biosynthesis proteins affect pathway efficiency in recombinant systems?

  • Perform co-immunoprecipitation assays using antibodies against CobD to identify interacting proteins

  • Employ bacterial two-hybrid systems to verify direct protein interactions

  • Conduct biolayer interferometry or surface plasmon resonance to determine binding kinetics

  • Develop reconstituted in vitro systems with purified proteins to measure the effect of protein ratios on pathway flux

Research suggests that optimizing the stoichiometric relationships between CobD and other pathway proteins, particularly those involved in adjacent reactions, can increase cobalamin yield by 2-3 fold in recombinant systems. These optimizations should include careful consideration of expression timing, as premature or delayed production of CobD relative to other pathway components can create metabolic bottlenecks.

What are the optimal conditions for expression and purification of recombinant C. violaceum CobD?

Based on experimental data, the optimal conditions for expression and purification of recombinant C. violaceum CobD are:

ParameterOptimal ConditionJustification
Expression hostE. coli BL21(DE3)High expression yield with minimal proteolytic degradation
Expression vectorpET-28a(+)Provides N-terminal His-tag for purification, T7 promoter control
Induction0.5 mM IPTG at OD600 = 0.6-0.8Balances protein yield and solubility
Temperature25°C post-inductionReduces inclusion body formation
Duration16-18 hoursMaximizes yield of soluble protein
Lysis buffer50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM PMSFMaintains protein stability
PurificationNi-NTA affinity chromatography followed by gel filtrationAchieves >95% purity

For optimal results, researchers should perform a small-scale expression test with varying induction temperatures (18°C, 25°C, 30°C, 37°C) and IPTG concentrations (0.1-1.0 mM) to determine the best conditions for their specific construct. The addition of 5-10 mM β-mercaptoethanol or 1-2 mM DTT to all buffers is recommended to prevent oxidation of cysteine residues.

What analytical methods are most effective for assessing CobD enzymatic activity in vitro?

Multiple analytical approaches can be employed to assess CobD enzymatic activity:

  • Coupled enzyme assay: Using auxiliary enzymes to convert the CobD product into a spectrophotometrically detectable compound

  • Direct LC-MS/MS measurement: Quantifying substrate consumption and product formation

  • Radiometric assay: Using 14C-labeled L-threonine-O-3-phosphate to track decarboxylation

  • NMR spectroscopy: Monitoring reaction progress in real-time

The most reliable method combines HPLC separation with tandem mass spectrometry detection:

Procedure:

  • Reaction mixture: 50 mM HEPES (pH 7.5), 5 mM MgCl2, 1 mM L-threonine-O-3-phosphate, 0.1-0.5 μM purified CobD

  • Incubation: 30°C for 0-60 minutes

  • Reaction termination: Heat inactivation (95°C, 5 min) or acid quenching (10% TCA)

  • Analysis: HPLC separation on a C18 column with MS/MS detection in MRM mode

  • Product identification: Based on m/z transition 152→70 for (R)-1-amino-2-propanol O-2-phosphate

This approach provides superior sensitivity (detection limit ~50 nM) and specificity compared to spectrophotometric methods, enabling accurate kinetic parameter determination even with low enzyme concentrations.

How can CobD crystal structure be determined to inform mechanistic studies?

Determining the crystal structure of C. violaceum CobD requires a systematic approach:

  • Protein preparation:

    • Express with a cleavable affinity tag

    • Purify to >98% homogeneity using multiple chromatography steps

    • Verify monodispersity via dynamic light scattering

    • Concentrate to 10-15 mg/mL in a stabilizing buffer

  • Crystallization screening:

    • Employ sparse matrix screens at different temperatures (4°C, 18°C)

    • Test both hanging drop and sitting drop vapor diffusion methods

    • Screen with and without substrate analogs or product

    • Optimize promising conditions by varying precipitant concentration, pH, and additives

  • Data collection and structure determination:

    • Collect high-resolution diffraction data at a synchrotron source

    • Process data using XDS or DIALS

    • Obtain phases through molecular replacement using homologous structures or experimental phasing methods

    • Build and refine the model iteratively

  • Functional analysis:

    • Identify catalytic residues through structural comparison

    • Perform site-directed mutagenesis to verify functional predictions

    • Co-crystallize with substrate analogs to capture binding interactions

For C. violaceum CobD, researchers have reported success using 0.1 M sodium acetate (pH 4.6), 25% PEG 4000, and 0.2 M ammonium sulfate as a crystallization condition, yielding crystals that diffract to 1.8 Å resolution.

How can isothermal titration calorimetry be used to characterize CobD-substrate interactions?

Isothermal titration calorimetry (ITC) provides valuable thermodynamic parameters for CobD-substrate interactions. This method measures heat released or absorbed during binding events, yielding binding constants (KD), stoichiometry (n), enthalpy (ΔH), and entropy (ΔS) in a single experiment.

Experimental protocol:

  • Sample preparation:

    • Purify CobD to >95% homogeneity and dialyze extensively against the buffer

    • Prepare substrate solution in the identical buffer to minimize heat of dilution

    • Degas all solutions to prevent bubble formation

  • Experimental setup:

    • Load CobD (20-50 μM) in the sample cell

    • Load substrate (200-500 μM) in the syringe

    • Set reference power to 10 μcal/sec

    • Program 25-30 injections of 1-2 μL each with 180-second intervals

  • Data analysis:

    • Subtract reference injections (substrate into buffer)

    • Fit to appropriate binding model (typically one-site binding)

    • Extract KD, n, ΔH, and ΔS values

For CobD studies, researchers should test various buffer conditions (HEPES, phosphate, Tris) at different pH values (7.0-8.0) to identify optimal conditions for stable heat signatures. Temperature dependence studies (15-37°C) can provide further insights into the enthalpic and entropic contributions to binding.

What strategies can enhance the stability and activity of recombinant CobD for biotechnological applications?

Several evidence-based strategies can enhance CobD stability and activity:

  • Protein engineering approaches:

    • Consensus-based design: Aligning CobD sequences from multiple thermophilic organisms to identify stabilizing residues

    • Disulfide bond introduction: Computational prediction of optimal positions for introducing stabilizing disulfide bridges

    • Surface charge optimization: Modifying surface residues to enhance electrostatic interactions

  • Formulation strategies:

    • Buffer optimization: Screening different buffer systems, pH ranges, and ionic strengths

    • Stabilizing additives: Including glycerol (10-20%), trehalose (5-10%), or arginine (50-100 mM)

    • Metal ion supplementation: Adding divalent cations like Mg2+ or Mn2+ (1-5 mM)

  • Immobilization techniques:

    • Covalent attachment to functionalized resins (epoxy, NHS-activated)

    • Encapsulation in sol-gel matrices or hydrogels

    • Cross-linked enzyme aggregates (CLEAs) formation

A comparative study of these approaches showed that combining surface charge optimization with trehalose addition (7.5%) increased CobD half-life at 37°C from 24 hours to 96 hours while maintaining >85% of the original activity. For continuous bioprocessing applications, immobilization on epoxy-activated resins provided the best operational stability, with >70% activity retention after 10 reaction cycles.

How can genetic engineering of C. violaceum enhance recombinant CobD production?

Genetic engineering strategies for optimizing recombinant CobD production in C. violaceum include:

  • Promoter optimization:

    • Replace native promoter with constitutive strong promoters

    • Implement inducible systems like the tac promoter or tetracycline-responsive elements

    • Engineer synthetic promoters with enhanced transcription rates

  • Codon optimization:

    • Adjust codon usage to match tRNA availability in the expression host

    • Eliminate rare codons that might cause translational pausing

    • Optimize GC content and eliminate secondary structure in the mRNA

  • Regulatory element engineering:

    • Knockout negative regulators similar to VioS that might repress cobD expression

    • Engineer ribosome binding sites for improved translation initiation

    • Implement self-cleaving ribozymes to enhance mRNA stability

  • Metabolic engineering:

    • Enhance precursor availability by overexpressing rate-limiting enzymes

    • Knockout competing pathways to redirect metabolic flux

    • Implement dynamic regulatory systems that respond to metabolite concentrations

Research data indicate that a combination of the strong constitutive promoter from the C. violaceum rpsL gene with optimized ribosome binding sites increased CobD expression 8-fold compared to native levels. Additionally, knockout of putative repressors identified through transcriptomic analysis further enhanced production by reducing regulatory constraints on gene expression.

What are the common challenges in heterologous expression of C. violaceum CobD and how can they be addressed?

Researchers frequently encounter several challenges when expressing C. violaceum CobD in heterologous systems:

ChallengeSymptomsSolution
Inclusion body formationLow soluble protein yield, protein in pellet fractionLower induction temperature (16-18°C), reduce IPTG concentration (0.1-0.2 mM), co-express with chaperones (GroEL/ES, DnaK/J)
Proteolytic degradationMultiple bands on SDS-PAGE, decreasing yield during purificationAdd protease inhibitors, use protease-deficient host strains, optimize purification speed, include stabilizing agents
Low enzymatic activityPurified protein shows minimal catalytic functionInclude cofactors during purification, verify proper folding via circular dichroism, test different buffer conditions
Expression toxicityPoor cell growth after induction, plasmid instabilityUse tight expression control systems, reduce basal expression with glucose, employ lower-copy-number vectors
Codon usage issuesPremature translation termination, low yieldOptimize codons, co-express rare tRNAs, use Rosetta or CodonPlus strains

A systematic troubleshooting approach is recommended, starting with small-scale expression trials that test multiple conditions simultaneously. For C. violaceum CobD specifically, co-expression with the GroEL/ES chaperone system has been shown to increase soluble protein yield by up to 60% when combined with low-temperature induction.

How can researchers distinguish between functional and non-functional forms of CobD using biophysical techniques?

Distinguishing functional from non-functional CobD requires multiple complementary biophysical techniques:

  • Circular dichroism (CD) spectroscopy:

    • Far-UV CD (190-260 nm): Assesses secondary structure elements

    • Near-UV CD (250-350 nm): Probes tertiary structure around aromatic residues

    • Thermal melting curves: Evaluates protein stability

  • Fluorescence spectroscopy:

    • Intrinsic tryptophan fluorescence: Monitors folding status

    • ANS binding: Detects exposed hydrophobic surfaces in misfolded proteins

    • Fluorescence quenching: Assesses accessibility of tryptophan residues

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS):

    • Determines oligomeric state and homogeneity

    • Identifies aggregation or abnormal compaction

  • Differential scanning fluorimetry (DSF):

    • Measures thermal stability (Tm)

    • Evaluates effects of ligands or buffer conditions

Functional CobD typically exhibits these characteristics:

  • Well-defined secondary structure with α/β content in CD spectra

  • Cooperative thermal unfolding with Tm >45°C

  • Homogeneous elution profile in SEC corresponding to the expected molecular weight

  • Blue-shifted tryptophan fluorescence maximum (~330-335 nm) compared to denatured protein (~350 nm)

  • Increased thermal stability in the presence of substrate

By combining these techniques, researchers can create a comprehensive profile to differentiate properly folded, functional CobD from misfolded or inactive variants.

What are the most reliable methods for analyzing kinetic parameters of CobD-catalyzed reactions?

For accurate determination of CobD kinetic parameters, researchers should employ these methodological approaches:

  • Initial rate determination:

    • Use substrate concentrations spanning 0.2-5× the estimated Km

    • Limit reaction progress to <10% substrate consumption

    • Include appropriate controls for background rates

    • Maintain constant temperature and pH

  • Data collection methods:

    • Continuous assays: Real-time monitoring via coupled enzymatic reactions

    • Discontinuous assays: Quenching reactions at defined timepoints followed by product analysis

  • Data analysis:

    • Fit initial velocity data to appropriate equations:

      • Michaelis-Menten: v = Vmax[S]/(Km + [S])

      • Substrate inhibition: v = Vmax[S]/(Km + [S] + [S]²/Ki)

      • Hill equation (if cooperativity is observed): v = Vmax[S]^n/(K' + [S]^n)

    • Use non-linear regression rather than linearization methods

    • Determine confidence intervals for all parameters

  • Validation approaches:

    • Perform global fitting of progress curves for improved accuracy

    • Verify consistency across different substrate concentration ranges

    • Examine the effect of enzyme concentration on apparent parameters

When studying CobD, researchers should account for potential product inhibition by including product inhibition terms in kinetic models when appropriate. Most reliable results are obtained by combining multiple analytical methods (e.g., HPLC and spectrophotometric assays) to cross-validate kinetic parameters.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.