Recombinant Chromobacterium violaceum Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant dsbB refers to the laboratory-produced version of the native Chromobacterium violaceum membrane protein involved in disulfide bond formation. Its primary function is to transfer electrons from DsbA to ubiquinone, linking oxidative protein folding to the respiratory chain . In C. violaceum, this protein is encoded by the gene CV_3193 (UniProt: Q7NT68) .

Redox Mechanism

  • Interaction with DsbA: DsbB oxidizes DsbA via disulfide exchange, regenerating DsbA’s active site for subsequent substrate oxidation .

  • Quinone Coupling: Electrons are transferred to ubiquinone, forming a transient thiolate-quinone charge-transfer complex . This step is rate-limiting and stabilized by ionic interactions with arginine residues .

Solubility Engineering

A water-soluble DsbB variant retains catalytic activity when co-expressed with DsbA in E. coli’s cytoplasm, enabling disulfide bond formation in substrate proteins like C. violaceum virulence factors .

Pathogenicity Links

  • Virulence Regulation: C. violaceum dsbB is implicated in the secretion of toxins, metallopeptidases, and biofilm-associated proteins .

  • Antibiotic Response: Sublethal doses of translation-inhibiting antibiotics (e.g., hygromycin A) upregulate dsbB-linked pathways, enhancing violacein production and biofilm formation .

Strain Misidentification Note

C. violaceum ATCC 31532, historically used in dsbB studies, was reclassified as C. subtsugae in 2020 due to genomic and phenotypic discrepancies . Researchers must verify strain identifiers to avoid misinterpretation .

Applications and Biotechnological Potential

ApplicationDescription
BiocatalysisEngineered soluble dsbB variants enable cytoplasmic disulfide bond formation in heterologous proteins .
Antimicrobial ResearchStudying dsbB’s role in virulence informs drug targeting against beta-proteobacteria .
Protein EngineeringRecombinant dsbB aids in optimizing oxidative folding for industrial enzymes .

Research Gaps and Future Directions

  • Structural Studies: No high-resolution structures of C. violaceum dsbB exist; homology models rely on E. coli DsbB (PDB: 2hi7) .

  • Regulatory Networks: The interplay between dsbB, quorum sensing, and antibiotic resistance remains underexplored .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, kindly consult your local distributors.
Note: All our proteins are shipped standard with blue ice packs. Should you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and serves as a guideline.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
dsbB; CV_3193; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)
Target Names
dsbB
Target Protein Sequence
MGLNITNRQGFLLVAAACAGAIGFALFAQYQLGEEPCPLCILQRIGVMAVGALALLAALH NPGKTGAKVWGGLMTLAALSGAGVSLRQLWLQSLPADQVPQCGPGLEFLMESFPLWEVLS KVLKGSGECAAIQGRFLGMTMPFWVAVFFAGVIVWTLWLVGRRRRG
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links

KEGG: cvi:CV_3193

STRING: 243365.CV_3193

Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Chromobacterium violaceum and why is it significant for disulfide bond research?

Chromobacterium violaceum is a gram-negative bacterium abundant in soil and water ecosystems in tropical and subtropical regions. It produces a characteristic purple pigment called violacein and occasionally causes severe and often fatal human and animal infections . The significance of C. violaceum in disulfide bond research stems from its unique ability to form regulated disulfide bonds in several of its proteins, making it an excellent model organism for studying redox-dependent protein modifications. The bacterium's pathogenicity and environmental adaptability are closely linked to proper protein folding mechanisms, including disulfide bond formation, which contributes to protein stability and function. The study of disulfide bond formation proteins in C. violaceum provides valuable insights into bacterial pathogenesis and potential therapeutic targets for this opportunistic pathogen with high fatality rates .

How do disulfide bonds contribute to protein structure and function in C. violaceum?

Disulfide bonds in C. violaceum proteins serve both structural and regulatory roles. Structurally, these covalent bonds stabilize tertiary protein conformations, particularly in secreted or membrane proteins exposed to oxidizing environments. Functionally, disulfide bonds can act as redox switches that alter enzymatic activity and protein localization within the cell. In C. violaceum, disulfide bond formation appears to be a regulated mechanism rather than a spontaneous process, suggesting its importance in cellular responses to environmental changes .

The formation of intermolecular disulfide bonds has been observed in several C. violaceum proteins, such as OhrR, where specific cysteine residues (e.g., Cys21 and Cys126) form intermolecular disulfide bonds upon oxidation . This oxidation-reduction mechanism allows for rapid response to oxidative stress conditions. Proteins involved in disulfide bond formation, including dsbB, are part of this sophisticated cellular machinery that ensures proper protein folding and function in various physiological contexts.

What is the relationship between disulfide bond formation and C. violaceum pathogenicity?

The relationship between disulfide bond formation and C. violaceum pathogenicity is multifaceted. Properly formed disulfide bonds are crucial for the structural integrity and function of virulence factors, including toxins and adhesins that contribute to bacterial invasion and immune evasion. The violacein pigment, which confers virulence properties to C. violaceum, depends on correct protein folding facilitated by disulfide bond-forming proteins .

C. violaceum infections typically progress rapidly, with hematogenic spread leading to sepsis and multiple organ abscess formation . The integrity of bacterial surface proteins and secreted factors involved in this dissemination depends on proper disulfide bond formation. Additionally, proteins involved in biofilm formation, an important virulence determinant, may require disulfide bonds for proper function. Research has shown that quorum sensing regulates morphological differentiation associated with biofilm development in C. violaceum , and proper protein folding through disulfide bond formation likely plays a role in this process.

What experimental approaches are most effective for characterizing recombinant C. violaceum dsbB function?

Multiple complementary approaches should be employed for comprehensive characterization of recombinant C. violaceum dsbB:

  • Genetic complementation assays: Construct dsbB deletion mutants and complement with recombinant dsbB to assess functional restoration. Similar to studies with OhrA/OhrR systems, site-directed mutagenesis of conserved cysteine residues can identify critical amino acids for function .

  • Protein oxidation state analysis: Use non-reducing SDS-PAGE to visualize intermolecular disulfide bond formation, as demonstrated with OhrR protein . This approach reveals monomeric versus dimeric states under different oxidation conditions.

  • Enzymatic activity assays: Develop peroxide consumption assays similar to those used for OhrA characterization to measure the functional activity of dsbB-dependent proteins .

  • Thiol-disulfide exchange monitoring: Spectrophotometric methods using DTNB (5,5'-dithio-bis-2-nitrobenzoic acid) can measure thiol-disulfide exchange reactions catalyzed by dsbB .

  • Structural biology approaches: X-ray crystallography or NMR spectroscopy to determine three-dimensional structure and identify key functional domains.

To ensure reproducibility, purified recombinant dsbB should be characterized in both reduced and oxidized states, and its interactions with substrate proteins should be evaluated under physiologically relevant conditions.

How do mutations in conserved cysteine residues affect dsbB function in C. violaceum?

Based on studies of other disulfide bond-forming proteins in C. violaceum, mutations in conserved cysteine residues would likely have profound effects on dsbB function. Research on the OhrR protein demonstrates the differential roles of cysteine residues in disulfide bond formation and redox sensing :

Cysteine MutationEffect on OhrR FunctionPotential Parallel in dsbB
C21SLoss of organic hydroperoxide sensingLoss of primary redox-sensing capability
C126SPrevention of intermolecular disulfide bond formationDisruption of catalytic disulfide transfer
C7SMinimal effect on functionMay represent non-essential structural cysteine
C143SMinimal effect on functionMay represent non-essential structural cysteine

Mutations in catalytic cysteines of dsbB would likely abolish its ability to reoxidize partner proteins (such as dsbA) in the periplasm. This would disrupt the electron transfer cascade necessary for introducing disulfide bonds into substrate proteins. Similar to OhrR, where C21S mutation prevents response to oxidants, mutations in key dsbB cysteines would likely result in accumulation of reduced substrate proteins, affecting virulence factor maturation and bacterial fitness .

Complementation experiments with site-directed mutants, coupled with functional assays measuring substrate oxidation rates, would provide valuable insights into the specific roles of individual cysteine residues in the catalytic mechanism of dsbB.

What is the relationship between quorum sensing and disulfide bond formation in C. violaceum?

The relationship between quorum sensing (QS) and disulfide bond formation in C. violaceum represents an intriguing intersection of bacterial communication and protein biochemistry. Research has established that C. violaceum employs a sophisticated QS system dependent on N-hexanoyl-L-homoserine lactone (C6-HSL) as an autoinducer . This QS system regulates morphological differentiation associated with biofilm development, which involves extensive remodeling of the bacterial envelope.

The formation of properly folded envelope proteins during biofilm development likely requires functional disulfide bond formation machinery. AFM studies have revealed that QS in C. violaceum directs morphological changes including invaginations of the external cytoplasmic membrane and formation of polymer matrix extrusions . These structural modifications involve numerous membrane and secreted proteins whose proper folding may depend on disulfide bond formation.

While direct evidence linking dsbB activity to QS has not been explicitly demonstrated, several lines of indirect evidence suggest a functional relationship:

  • QS-regulated processes (biofilm formation, virulence factor production) involve extracytoplasmic proteins that typically contain disulfide bonds

  • Environmental stresses that trigger QS responses often also alter the cellular redox state

  • The temporal coordination of protein expression and folding during QS-mediated responses likely involves synchronized disulfide bond formation

Experimental approaches to investigate this relationship could include transcriptomic analysis of dsbB expression in response to QS autoinducers, phenotypic characterization of dsbB mutants for QS-dependent behaviors, and biochemical analysis of disulfide bond content in proteins regulated by QS.

How does the thioredoxin system interact with disulfide bond-containing proteins in C. violaceum?

The thioredoxin system plays a critical role in the reduction of oxidized disulfide bond-containing proteins in C. violaceum. Research on the OhrR protein has demonstrated that oxidized OhrR, inactivated by intermolecular disulfide bond formation, is specifically regenerated via thiol-disulfide exchange by thioredoxin . This finding reveals a physiological reducing system for this thiol-based redox switch.

Importantly, other potential thiol reducing agents such as glutaredoxin, glutathione, and lipoamide were found to be ineffective in regenerating reduced OhrR . This specificity suggests that the thioredoxin system has evolved to recognize particular structural features of oxidized C. violaceum proteins.

The thioredoxin-dependent reduction process involves several steps:

  • Recognition of the oxidized protein by thioredoxin

  • Nucleophilic attack by the thioredoxin active site thiolate on the disulfide bond

  • Formation of a mixed disulfide intermediate

  • Resolution of the mixed disulfide by the second thioredoxin cysteine

  • Release of reduced protein and oxidized thioredoxin

For dsbB and other disulfide bond-forming proteins, the interaction with thioredoxin may serve as a regulatory mechanism that coordinates redox homeostasis with protein folding processes. Under oxidative stress conditions, the balance between oxidative folding and reductive pathways determines the net disulfide bond content of cellular proteins, affecting their structure and function.

What analytical techniques can best detect and quantify disulfide bond formation in recombinant C. violaceum proteins?

Multiple analytical techniques can be employed to detect and quantify disulfide bond formation in recombinant C. violaceum proteins, each with specific advantages:

  • Non-reducing vs. reducing SDS-PAGE: This technique allows visualization of mobility differences between oxidized and reduced proteins, as demonstrated with OhrR, where disulfide-bonded dimers (40 kDa) can be distinguished from monomers (20 kDa) . This provides qualitative assessment of disulfide bond status.

  • Mass spectrometry (MS): High-resolution MS can identify disulfide-linked peptides and determine their exact positions. Techniques include:

    • Liquid chromatography-tandem mass spectrometry (LC-MS/MS)

    • Differential alkylation of free vs. disulfide-bonded cysteines

    • Isotope-coded affinity tag (ICAT) labeling

  • Spectrophotometric assays: DTNB (Ellman's reagent) reacts with free thiols to produce a colored product measurable at 412 nm, allowing quantification of free vs. disulfide-bonded cysteines .

  • Fluorescence-based assays: Thiol-reactive fluorescent probes can be used to monitor disulfide bond formation in real-time.

  • X-ray crystallography and NMR: These structural techniques provide detailed spatial information about disulfide bond positions and protein conformational changes upon oxidation.

Table: Comparison of Analytical Techniques for Disulfide Bond Analysis

TechniqueAdvantagesLimitationsApplication in C. violaceum
Non-reducing SDS-PAGESimple, accessible, visualizes intermolecular disulfidesSemi-quantitative, limited resolutionSuccessfully used with OhrR
Mass spectrometryHigh specificity, can map exact disulfide positionsComplex sample preparation, expensiveApplicable to purified recombinant proteins
DTNB assayQuantitative, simple procedureIndirect measurementUsed to confirm reductase activity
Crystallography/NMRDetailed structural informationResource-intensive, requires stable proteinPotential for future structural studies

For comprehensive analysis of disulfide bond dynamics in C. violaceum proteins, combining multiple techniques is recommended to overcome the limitations of individual approaches.

What expression systems are optimal for producing functional recombinant C. violaceum dsbB?

Selecting an appropriate expression system for recombinant C. violaceum dsbB requires careful consideration of several factors:

  • Prokaryotic vs. Eukaryotic Expression: E. coli remains the preferred system for bacterial membrane proteins like dsbB due to similar membrane architecture. BL21(DE3) strains with reduced proteolytic activity and tunable expression are particularly suitable.

  • Expression vectors: Vectors with moderate-strength promoters (e.g., trc or tac rather than T7) often yield better results for membrane proteins by preventing toxic accumulation. Fusion tags (His6, MBP, SUMO) can enhance solubility and facilitate purification.

  • Growth conditions:

    • Temperature: Lower temperatures (16-25°C) often improve proper folding

    • Induction: Gradual induction with low IPTG concentrations (0.1-0.5 mM)

    • Media supplements: Addition of membrane-stabilizing agents like glycerol (5-10%)

  • Membrane extraction considerations: Detergent selection is critical for dsbB extraction while preserving function. Initial screening should include mild detergents such as n-dodecyl-β-D-maltopyranoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin.

Based on successful approaches with other redox-active C. violaceum proteins, a recommended starting protocol would include:

  • pET-based vector with His-tag

  • BL21(DE3) host strain

  • Growth at 25°C after induction with 0.2 mM IPTG

  • Membrane fraction isolation followed by detergent solubilization

  • Functional validation through activity assays measuring thiol-disulfide exchange capacity

When designing expression constructs, careful attention should be paid to preserving the transmembrane topology of dsbB to ensure proper insertion into the membrane and maintenance of functional catalytic sites.

How can researchers establish reliable assays for measuring dsbB activity in vitro?

Establishing reliable in vitro assays for C. violaceum dsbB activity requires methods that can detect the enzyme's ability to catalyze disulfide bond formation or thiol-disulfide exchange. Based on approaches used with other disulfide-forming proteins in C. violaceum, the following assays are recommended:

  • Coupled enzyme assays: A system coupling dsbB activity to the oxidation of its natural substrate dsbA, which in turn oxidizes a reporter substrate. The rate of reporter substrate oxidation reflects dsbB activity.

  • Quinone reduction monitoring: dsbB typically transfers electrons from dsbA to membrane-bound quinones. Monitoring quinone reduction spectrophotometrically (275-290 nm) provides a direct measure of dsbB activity.

  • Fluorescence-based assays: Utilizing fluorogenic peptide substrates containing engineered dicysteine motifs. Upon oxidation, fluorescence properties change in a measurable way.

  • Oxygen consumption assays: In reconstituted systems, the electron transport from dsbB to terminal oxidases can be measured as oxygen consumption using oxygen electrodes.

For meaningful results, assay conditions should mimic the periplasmic environment:

  • pH 6.5-7.0

  • Physiological salt concentrations (100-150 mM NaCl)

  • Appropriate membrane mimetics (nanodiscs, liposomes, or mild detergents)

  • Presence of relevant quinones (ubiquinone or menaquinone)

Control experiments should include:

  • Heat-inactivated enzyme controls

  • Catalytic cysteine mutants

  • Specific inhibitors (if available)

  • Variation of substrate concentrations to determine kinetic parameters

Validation of assay reliability should include demonstrations of proportionality between enzyme concentration and activity, reproducibility across independent enzyme preparations, and sensitivity to known modulators of disulfide bond formation.

What strategies can overcome challenges in studying membrane-associated disulfide bond formation proteins?

Membrane-associated disulfide bond formation proteins like dsbB present several experimental challenges that require specialized approaches:

  • Protein solubilization and purification:

    • Systematic detergent screening (starting with DDM, LDAO, and FC-12)

    • Lipid-based systems including nanodiscs, bicelles, or SMALPs (styrene-maleic acid lipid particles)

    • Stabilization through fusion partners (e.g., T4 lysozyme) inserted into flexible loops

  • Maintaining native conformation:

    • Addition of stabilizing lipids during purification (phosphatidylethanolamine, cardiolipin)

    • Use of scFv antibody fragments or nanobodies to stabilize native conformations

    • Inclusion of physiological quinones to stabilize the native electron transport complex

  • Functional reconstitution:

    • Controlled reconstitution into liposomes with defined lipid composition

    • Co-reconstitution with interaction partners (dsbA, quinones)

    • Development of solid-supported membrane systems for activity measurements

  • Structural analysis approaches:

    • Cryo-electron microscopy as an alternative to crystallography

    • Hydrogen-deuterium exchange mass spectrometry to probe conformational dynamics

    • Site-directed spin labeling coupled with EPR spectroscopy to analyze membrane topology

  • Genetic approaches to complement biochemical studies:

    • Construction of cysteine-less variants as background for introducing reporter cysteines

    • In vivo disulfide trapping to capture transient interaction partners

    • Suppressor mutation analysis to identify functional interactions

Each of these strategies addresses specific challenges in the expression, purification, and functional characterization of membrane-associated disulfide bond formation proteins. A comprehensive approach combining multiple techniques typically yields the most reliable results when studying complex membrane proteins like dsbB from C. violaceum.

How does C. violaceum dsbB compare to homologous proteins in other bacterial species?

Comparative analysis of C. violaceum dsbB with homologs from other bacterial species reveals important insights into its function and evolution:

  • Conserved features across bacterial dsbB proteins:

    • Four transmembrane helices with two periplasmic loops

    • Two conserved cysteine pairs (one in each periplasmic loop)

    • Quinone-binding domain for electron transfer

  • Unique features of C. violaceum dsbB:
    Based on analysis of other C. violaceum redox proteins, its dsbB likely exhibits:

    • Adaptation to the specific redox environment of soil and water ecosystems

    • Potential regulatory mechanisms linked to virulence factor expression

    • Possible integration with stress response systems specific to C. violaceum

  • Functional comparison with model organisms:

OrganismKey dsbB FeaturesDistinctive PropertiesRelevance to C. violaceum
E. coliWell-characterized kinetics, crystal structure availableFunctions in aerobic/anaerobic conditionsServes as reference model
P. aeruginosaLinked to virulence, biofilm formationMultiple paralogs with specialized functionsSimilar niche adaptation
X. campestrisForms intermolecular disulfide bonds in OhrRSpecific thioredoxin-dependent reductionSimilar disulfide bond dynamics
N. meningitidisMember of same order (Neisseriales)Important for envelope stabilityClosest well-studied relative

The comparative analysis suggests that while C. violaceum dsbB likely shares the core catalytic mechanism with other bacterial dsbB proteins, it may have unique regulatory features adapted to its environmental niche and pathogenic lifestyle. The formation of intermolecular disulfide bonds observed in C. violaceum OhrR protein suggests that similar mechanisms may operate in its disulfide bond formation machinery, potentially distinguishing it from homologs in other species.

What role might dsbB play in C. violaceum's response to oxidative stress?

C. violaceum dsbB likely plays a multifaceted role in oxidative stress response, based on known functions of disulfide bond formation proteins and specific data from C. violaceum studies:

  • Coordination with dedicated oxidative stress systems: C. violaceum possesses the OhrA/OhrR system specifically for organic hydroperoxide detoxification . dsbB likely works in parallel with these systems, maintaining proper folding of stress response proteins.

  • Regulation of periplasmic redox state: During oxidative stress, dsbB would accelerate disulfide bond formation in newly synthesized proteins, preventing accumulation of misfolded proteins that could exacerbate stress.

  • Support for virulence during host-pathogen interactions: Host-generated oxidative burst is a primary defense against C. violaceum. The dsbB system would ensure proper folding of virulence factors and detoxification enzymes needed to counter host defenses.

  • Integration with thioredoxin system: Research has shown that the thioredoxin system specifically regenerates oxidized OhrR in C. violaceum , suggesting coordinated action between cytoplasmic and periplasmic redox systems during stress response.

  • Potential redox sensing function: Beyond its enzymatic role, dsbB might function as a redox sensor, modulating its activity based on periplasmic redox potential and thereby adjusting the rate of protein oxidation to environmental conditions.

The observation that C. violaceum mutants deficient in oxidative stress response genes show increased sensitivity to organic hydroperoxides suggests that proper disulfide bond formation is critical for survival under oxidative stress conditions. Further research specifically targeting dsbB would help elucidate its precise contribution to this complex response network.

How might inhibition of dsbB affect C. violaceum virulence and potential therapeutic applications?

Inhibition of dsbB in C. violaceum could significantly impact virulence through multiple mechanisms, suggesting potential therapeutic applications:

  • Disruption of virulence factor maturation: Many bacterial virulence factors require disulfide bonds for proper folding and function. Inhibiting dsbB would likely impair the production of functional toxins, adhesins, and secretion system components necessary for C. violaceum pathogenesis .

  • Impairment of stress resistance: C. violaceum infections involve survival against host immune defenses, including oxidative bursts. Compromised dsbB function would likely reduce bacterial survival under these stressful conditions, similar to the increased sensitivity observed in ohrA mutants to organic hydroperoxides .

  • Disruption of biofilm formation: Biofilms contribute to C. violaceum pathogenicity and antibiotic resistance. The morphological differentiation associated with biofilm development is regulated by quorum sensing and likely depends on proper protein folding mediated by disulfide bond formation.

  • Therapeutic potential:

    • Small molecule inhibitors targeting the unique aspects of C. violaceum dsbB could provide selective antimicrobial activity

    • Combination therapy with conventional antibiotics might exploit synergistic effects

    • Anti-virulence strategy could reduce pathogenicity without imposing strong selective pressure for resistance

  • Therapeutic challenges:

    • Need to achieve selectivity over human disulfide isomerases

    • Requirement for periplasmic penetration

    • Potential for compensatory mechanisms

The high fatality rate of C. violaceum infections and challenges with antibiotic resistance make novel therapeutic targets particularly valuable. The essential nature of disulfide bond formation for bacterial virulence, combined with structural differences between bacterial and eukaryotic enzymes, positions dsbB as a promising target for anti-virulence approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.