Recombinant Chromobacterium violaceum Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Biosynthesis and Purification

Recombinant MsbA is produced in E. coli expression systems, enabling high-yield extraction and functional studies .

Role in Lipid A Transport:

  • MsbA employs an ATP-dependent "trap and flip" mechanism to translocate lipid A .

  • Structural studies reveal a large transmembrane portal opening (~2.8 Å resolution) for lipid A entry .

  • Mutations in msbA disrupt lipid A core oligosaccharide transport, leading to toxic accumulation in the cytoplasm .

Antibiotic Resistance Implications:

  • MsbA is a target for novel antibiotics due to its essential role in LPS biogenesis in pathogens .

  • Overexpression of ABC transporters like MsbA correlates with multidrug resistance (MDR) phenotypes in E. coli and Salmonella .

Key Studies:

  1. Conformational Dynamics
    Cryo-EM analyses demonstrate MsbA’s structural plasticity in diverse membrane mimetics (detergents, nanodiscs) .

    • Detergents stabilize wide NBD (nucleotide-binding domain) separations.

    • Nanodiscs favor narrow conformations, mimicking physiological states .

  2. Mechanistic Comparisons
    C. violaceum MsbA shares functional homology with homologs in Yersinia pseudotuberculosis (Q66CI3) and Burkholderia thailandensis (Q2SZW0) .

  3. Biotechnological Relevance

    • Recombinant MsbA aids in studying LPS assembly and antibiotic resistance .

    • Proteomic studies in C. violaceum under stress highlight MsbA’s role in membrane adaptation .

Significance in Pathogenesis

  • MsbA is critical for C. violaceum virulence, enabling survival in hostile environments (e.g., oxidative stress) .

  • Secreted proteins like collagenase and chitinase, regulated alongside MsbA, enhance pathogenicity and environmental adaptability .

Comparative Analysis of MsbA Homologs:

SpeciesUniProt IDLength (aa)Key Features
C. violaceumQ7NZU6584His-tagged, lipid A flippase
Y. pseudotuberculosisQ66CI3582Full-length, ATP-dependent transport
B. thailandensisQ2SZW0596Induced by magnesium limitation

Future Directions

  • Drug Development: Targeting MsbA’s ATP-binding domain could disrupt LPS assembly in pathogens .

  • Structural Biology: High-resolution cryo-EM studies to map lipid A interaction sites .

  • Environmental Adaptation: Role of MsbA in C. violaceum biofilm formation under nutrient stress .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please contact your local distributor.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard protocol includes 50% glycerol. You may use this as a reference for your own preparations.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms are stable for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you have a specific tag requirement, please inform us, and we will prioritize its inclusion during development.
Synonyms
msbA; CV_0825; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-584
Protein Length
full length protein
Species
Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)
Target Names
msbA
Target Protein Sequence
MKDSFKNSWAIYRRLLGYLLGYWKVLLLSMLSMAVAALTEPAVAKLLKPLIDGGFVNKDP QVIMWVPLAIIGIYLIRGLAGFINEYTASWLTGQLVQRLRQQMFAKLVNLPARYYDEHQS GRLMSRITNDVNQVTEAGFNVITVTVRDGLTALGMLGLMLTTDWQLTLICLVVMPAVTYC MRLVGQRLRGLARQNQQHMAQMTQVLAESIQCQRAIKVYGGQEREMARFDHTATSVRRNQ VKQSAASAANTGVTQLMIACALAAILYFAGLRAQHGGLTAGDFMVFLTAMLGLFAPVKRI SSVSQAMQRGLAAAESVFAFIDEPGEPDDGASALPATRGRLSFDAVSFAYPNVDSPALSG IDLEIQPGETVALVGSSGSGKTTLASLVPRFYEPSAGRLLLDGVPLADIPLRQLRGHIAL VSQQVELFNDTVAANIAYGREDASREEIVEAARAANAMEFIEGLPDGLETVIGENGARLS GGQRQRLAIARALLKNAPLLILDEATSALDTQSERLVQAALENLMKNRTTIVIAHRLSTI ENADRIVVMHQGRLAEQGRHQALLEQGGLYARLHSLQFSEPQAD
Uniprot No.

Target Background

Function
This protein is involved in lipopolysaccharide (LPS) biosynthesis. It facilitates the translocation of lipid A-core from the inner leaflet of the inner membrane to the outer leaflet. Transmembrane domains (TMD) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links

KEGG: cvi:CV_0825

STRING: 243365.CV_0825

Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is MsbA and what is its primary function in Chromobacterium violaceum?

MsbA is an essential ATP-binding cassette (ABC) transporter found in gram-negative bacteria, including Chromobacterium violaceum. Its primary function is to transport lipid A and lipopolysaccharide (LPS) from the cytoplasmic leaflet to the periplasmic leaflet of the inner membrane . This transport process is critical for the assembly of the outer cell membrane in gram-negative bacteria. MsbA is functionally characterized as a lipid flippase, which means it facilitates the movement of lipids from one side of the membrane to the other . In C. violaceum specifically, MsbA (encoded by the gene msbA, with ordered locus name CV_0825) plays this essential role in membrane biogenesis .

How is recombinant C. violaceum MsbA protein typically produced for research?

Recombinant C. violaceum MsbA protein is typically produced using standard recombinant protein expression systems. Based on available information, the production process generally includes:

  • Gene Cloning: The msbA gene (CV_0825) is amplified from C. violaceum genomic DNA and cloned into an appropriate expression vector.

  • Expression System: The recombinant protein is expressed in a suitable host system, which may include E. coli strains optimized for membrane protein expression.

  • Protein Tagging: The recombinant protein may include tags (though specific tag types are usually determined during the production process) to facilitate purification and detection .

  • Purification: Membrane proteins like MsbA require detergent-based extraction and purification methods. Advanced amphiphiles such as facial amphiphiles (FAs) have been shown to enhance the stability and activity of MsbA proteins during purification .

  • Storage: The purified protein is typically stored in a Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage . Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing is not recommended .

What experimental techniques are used to study MsbA function?

Several experimental techniques are employed to study MsbA function:

TechniqueApplicationKey Parameters
ATPase Activity AssaysMeasures the ATP hydrolysis rate of MsbAActivity range: 6-10 μmol ATP/min/mg protein
Thermal Stability AssaysAssesses protein stability under different conditionsMelting temperature (Tm) of MsbA in FA-3: 63.3°C
X-ray CrystallographyDetermines high-resolution protein structureResolution achieved: up to 2.8 Å
Cryo-Electron MicroscopyVisualizes protein conformations in near-native stateProvides insights into dynamic conformational changes
Lipid Flipping AssaysMeasures transport of lipid substratesAssesses functional activity
Inhibition StudiesEvaluates potential inhibitorsE.g., vanadate inhibition of ATPase activity

These techniques provide complementary information about the structure-function relationship of MsbA and its role in lipid A transport.

What is the significance of C. violaceum as a model organism for studying MsbA?

Chromobacterium violaceum serves as an interesting model organism for studying MsbA for several reasons:

How does the structure-function relationship of MsbA contribute to lipid A transport mechanisms?

The structure-function relationship of MsbA reveals a sophisticated mechanism for lipid A transport across bacterial membranes. Structural studies of MsbA homologs, particularly from Salmonella typhimurium, have provided significant insights that are likely applicable to C. violaceum MsbA as well.

MsbA undergoes substantial conformational changes during its transport cycle:

  • Inward-facing Conformation: In this state, MsbA exhibits a large amplitude opening in the transmembrane portal, which allows lipid A to enter from the cytoplasmic leaflet. X-ray crystallography studies have revealed that this opening is wide enough to accommodate the bulky lipid A molecule .

  • Intermediate Conformations: As lipid A enters the transmembrane cavity, MsbA transitions through intermediate states. Electron density attributed to lipid A has been observed inside the transmembrane cavity, supporting a "trap and flip" model of transport .

  • Outward-facing Conformation: Upon ATP binding and hydrolysis, MsbA transitions to an outward-facing conformation that facilitates the release of lipid A to the periplasmic leaflet.

Interestingly, additional electron density attributed to lipid A has been observed near an outer surface cleft at the periplasmic ends of the transmembrane helices, suggesting a possible post-transport lipid A docking site . This observation provides new insights into how lipid A might be transferred to subsequent components of the LPS transport pathway.

The nucleotide-binding domains (NBDs) play a critical role in this process, as their separation and coming together drive the conformational changes of the transmembrane domains. The NBD separation observed in various structures correlates with different functional states of the transporter .

What are the challenges in obtaining high-resolution structural data for MsbA and how can they be overcome?

Obtaining high-resolution structural data for membrane proteins like MsbA presents several significant challenges:

  • Protein Stability: Membrane proteins are notoriously unstable when removed from their native lipid environment. This has been addressed using specialized detergents and amphiphiles such as facial amphiphiles (FAs), which have been shown to enhance the stability of MsbA. For example, MsbA exhibited a higher melting temperature (Tm) in FA-3 (63.3°C) compared to conventional detergents like UDM and LMNG (53.0°C and 58.6°C, respectively) .

  • Conformational Flexibility: MsbA undergoes significant conformational changes during its transport cycle, making it difficult to capture specific states. This has been addressed by using substrate analogs or inhibitors to stabilize particular conformations.

  • Weak Substrate Binding: The typically weak binding affinity and brief residence time of transport substrates make co-crystallization challenging . Researchers have overcome this by using high concentrations of substrates or substrate analogs during crystallization.

  • Crystal Packing: Membrane proteins often have large hydrophobic surfaces that make crystal formation difficult. The use of antibody fragments or other crystallization chaperones can facilitate crystal packing.

Recent advances that have enabled higher-resolution structures include:

  • Development of structurally unique amphiphiles like FA-3

  • Co-crystallization with lipid A or inhibitors to stabilize specific conformations

  • Use of thermal unfolding assays to assess protein stability under different conditions

  • Complementary use of X-ray crystallography and cryo-electron microscopy

These approaches have led to structures beyond 3 Å resolution, providing unprecedented insights into the molecular mechanisms of MsbA-mediated lipid transport .

How does MsbA function in the context of the complete LPS transport pathway in C. violaceum?

MsbA functions as a critical component in the multi-step LPS transport pathway in gram-negative bacteria like C. violaceum:

  • LPS Biosynthesis: Lipid A is synthesized on the cytoplasmic side of the inner membrane, where core oligosaccharides are also attached.

  • MsbA-mediated Flipping: MsbA transports lipid A, with or without core sugars, from the cytoplasmic leaflet to the periplasmic leaflet of the inner membrane . This is an energy-dependent process driven by ATP hydrolysis.

  • O-antigen Ligation: On the periplasmic side, O-antigen is ligated to the lipid A core, completing the LPS molecule .

  • Outer Membrane Transport: The completed LPS is then delivered to the cell surface by a complex of seven transport proteins (Lpt A-G) that span from the inner membrane to the outer membrane .

MsbA's essential role in this pathway is evidenced by the fact that defects in MsbA function can be partially compensated for by overexpression of other components in the pathway . Furthermore, the discovery of potential post-transport lipid A docking sites on the periplasmic face of MsbA suggests a mechanism for handoff to subsequent transport components.

In the context of C. violaceum, which is known to adapt to various environmental stresses , the regulation of MsbA activity may contribute to the bacterium's ability to adjust its membrane composition and properties in response to changing conditions.

What is the potential of MsbA as an antibiotic target, and what approaches are being explored?

MsbA represents a promising antibiotic target for several reasons:

  • Essential Function: MsbA is essential for the viability of most gram-negative pathogens, including opportunistic pathogens like C. violaceum . Inhibition of MsbA function would be lethal to these bacteria.

  • Conservation: MsbA is conserved across gram-negative bacteria but not present in humans, making it a selective target.

  • Accessibility: As a membrane protein facing both the cytoplasm and periplasm, MsbA may be accessible to inhibitors that do not need to fully penetrate the cellular interior.

Research approaches for targeting MsbA include:

ApproachDescriptionProgress
Small Molecule InhibitorsDevelopment of compounds that bind to MsbA and inhibit its ATPase activity or substrate transportSmall molecule antagonists like G907 have been identified and co-crystallized with MsbA
Peptide InhibitorsDesign of peptides that interfere with MsbA conformational changesBeing explored for various ABC transporters
Structure-Based Drug DesignUtilization of high-resolution structures to design inhibitors that target specific functional sitesAdvanced by recent structural studies at 2.8 Å resolution
Combination TherapiesUse of MsbA inhibitors together with other antibiotics to enhance efficacyPotential synergy with outer membrane-targeting compounds

The recent availability of high-resolution structures of MsbA in different conformational states and with bound inhibitors provides valuable templates for structure-based drug design efforts . For example, the identification of specific binding pockets for antagonists like G907 offers insights into how MsbA function can be inhibited.

What methodological advances have improved recombinant MsbA production and analysis?

Several methodological advances have significantly improved the production and analysis of recombinant MsbA:

  • Novel Detergents and Amphiphiles: The development of facial amphiphiles (FAs) like FA-3 has enhanced MsbA stability and activity during purification and crystallization . MsbA prepared in FA-3 exhibited ATPase activity comparable to that in lipid nanodiscs (6–10 μmol ATP/min/mg protein), which is significantly higher than in most conventional detergents .

  • Thermal Stability Assays: Specialized thermal unfolding assays that probe the accessibility of engineered single cysteines (e.g., A30C) to fluorescent reagents have provided a sensitive method to assess MsbA stability under different conditions . This has facilitated the optimization of buffer compositions and additive screening.

  • Co-crystallization Strategies: Co-crystallization with lipid A substrates or inhibitors, combined with the use of stabilizing amphiphiles, has enabled the determination of high-resolution structures (beyond 3 Å) .

  • Lipid Nanodisc Technology: Reconstitution of MsbA into lipid nanodiscs provides a more native-like membrane environment for functional studies, resulting in higher ATPase activity compared to detergent-solubilized preparations .

  • Complementary Structural Methods: The combined use of X-ray crystallography and cryo-electron microscopy has provided insights into different conformational states of MsbA, offering a more complete picture of its transport mechanism .

These methodological advances not only improve our understanding of MsbA structure and function but also provide valuable tools for studying other challenging membrane proteins.

How can insights from C. violaceum MsbA research contribute to understanding bacterial antibiotic resistance?

Research on C. violaceum MsbA provides valuable insights into bacterial antibiotic resistance mechanisms, particularly those involving membrane permeability and efflux:

  • Membrane Barrier Modulation: As a lipid A transporter essential for outer membrane assembly, MsbA indirectly contributes to the permeability barrier that restricts antibiotic entry. Understanding how MsbA function affects membrane composition and organization can reveal mechanisms by which bacteria modulate their susceptibility to antibiotics.

  • Potential Efflux Activity: MsbA may act as a flippase of glycerophospholipids in addition to lipid A , suggesting broader substrate specificity. This raises the possibility that MsbA or similar transporters might contribute to efflux of certain antibiotics, a common resistance mechanism.

  • Adaptation Mechanisms: C. violaceum's ability to adapt to various environmental stresses may involve changes in membrane composition facilitated by transporters like MsbA. Such adaptations could indirectly affect antibiotic susceptibility.

  • LPS Modifications: Bacteria often modify their LPS structure to resist antimicrobial peptides and certain antibiotics. As MsbA transports lipid A/LPS, understanding how it accommodates and transports modified substrates could reveal mechanisms of resistance development.

Future research combining structural studies of MsbA with analyses of antibiotic susceptibility in C. violaceum under various conditions could establish more direct links between MsbA function and resistance mechanisms.

What are the comparative characteristics of MsbA across different gram-negative bacterial species?

Comparative analysis of MsbA across different gram-negative bacterial species reveals both conserved features and species-specific adaptations:

SpeciesKey CharacteristicsStructural FeaturesFunctional Implications
Chromobacterium violaceum584 amino acids , encoded by CV_0825Full-length protein with typical ABC transporter domainsEssential for viability, potential role in environmental adaptation
Salmonella typhimuriumHigh-resolution structure available (2.8 Å) Inward-facing conformation with large transmembrane portalReveals lipid A binding sites and transport pathway
Escherichia coliWell-studied model systemTemperature-sensitive mutations identifiedDemonstrates essential nature of MsbA function
Other gram-negative pathogensConserved across speciesMay show species-specific substrate preferencesPotential broad-spectrum antibiotic target

Comparative structural and functional studies of MsbA from different species, including C. violaceum, could reveal:

  • Species-specific binding pockets that might be exploited for selective targeting

  • Differences in substrate specificity or transport efficiency

  • Variations in regulatory mechanisms

  • Differential responses to inhibitors or environmental conditions

What novel experimental approaches are being developed to study MsbA dynamics during transport cycles?

Several cutting-edge experimental approaches are being developed to study the dynamic aspects of MsbA function:

  • Time-resolved Cryo-EM: This technique captures proteins in different conformational states during their functional cycle, providing insights into the dynamic transitions between states.

  • Single-molecule FRET (Förster Resonance Energy Transfer): By labeling specific domains of MsbA with fluorescent probes, researchers can monitor conformational changes in real-time at the single-molecule level, revealing the dynamics and heterogeneity of the transport process.

  • Molecular Dynamics Simulations: Computational approaches based on high-resolution structural data can simulate the movements of MsbA in a lipid bilayer environment, providing atomic-level details of conformational changes and substrate interactions.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique measures the accessibility of different protein regions to solvent, providing information about conformational dynamics and ligand-induced structural changes.

  • Native Mass Spectrometry: Advanced mass spectrometry methods can analyze intact membrane protein complexes, providing insights into the stoichiometry and stability of MsbA assemblies under different conditions.

  • In situ Structural Biology: Techniques like electron tomography and correlative light and electron microscopy allow visualization of MsbA in its native cellular context, revealing how it interacts with other components of the LPS transport machinery.

These approaches, when applied to C. violaceum MsbA, would significantly enhance our understanding of how this essential transporter functions in the context of this environmentally adaptable bacterium.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.