Recombinant Chromobacterium violaceum NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage state, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
nuoK; CV_0951; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)
Target Names
nuoK
Target Protein Sequence
MLTLTHFLVLAAILFAISVLGIFLNRKNLIILLMAIELMLLAVNFNFIAFSHYLSDSAGQ IFVFFILTVAAAESAIGLAILVVLFRNLQSINVEDLGSLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this particular species, ubiquinone is believed to be the immediate electron acceptor for the enzyme. The enzyme couples the redox reaction to proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves redox energy in a proton gradient.
Database Links

KEGG: cvi:CV_0951

STRING: 243365.CV_0951

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of NADH-quinone oxidoreductase subunit K (nuoK) in the respiratory chain of Chromobacterium violaceum?

NuoK functions as an integral membrane subunit within the NADH:quinone oxidoreductase complex (Complex I or NDH-I) in C. violaceum. This complex catalyzes electron transfer from NADH to quinones while translocating protons across the membrane, contributing to the establishment of a proton motive force used for ATP synthesis.

C. violaceum possesses genes encoding both the proton-pumping NDH-I complex (containing nuoK) and a Na⁺-translocating NADH:quinone oxidoreductase (NQR), indicating a sophisticated respiratory system. This dual system likely provides metabolic flexibility, allowing the organism to adapt to diverse ecological niches and environmental conditions.

Membrane preparations from C. violaceum display NADH dehydrogenase activity of approximately 0.2 μmol min⁻¹ mg⁻¹, which is lower than that reported for organisms like Vibrio cholerae (0.4-0.5 μmol min⁻¹ mg⁻¹) . This activity represents the combined contribution of both NDH-I (including nuoK) and NQR complexes, highlighting the importance of specific inhibitors for distinguishing between these activities in experimental studies.

How can researchers differentiate between the activities of NDH-I (containing nuoK) and NQR in C. violaceum membrane preparations?

Researchers can exploit the differential sensitivity of these complexes to specific inhibitors:

Inhibitor Specificity Protocol

The most effective approach involves using silver ions (Ag⁺), which specifically inhibit NQR activity but do not affect NDH-I. As confirmed in experimental studies, "Silver ions particularly inhibit NADH oxidation of the NQR but do not affect the NDH-I complex" .

To implement this approach:

  • Prepare membrane fractions from C. violaceum cells

  • Measure baseline NADH dehydrogenase activity

  • Add micromolar concentrations of Ag⁺ (typically 1-10 μM)

  • Reassess NADH dehydrogenase activity

  • Calculate the difference to determine NQR contribution

The remaining Ag⁺-resistant activity can be attributed predominantly to the nuoK-containing NDH-I complex. For further confirmation, specific Complex I inhibitors like rotenone (10-50 μM) or piericidin A (1-10 μM) can be used to inhibit the remaining activity.

This differential inhibition approach is particularly valuable for researchers studying recombinant nuoK, as it allows assessment of whether the recombinant protein successfully integrates into a functional NDH-I complex.

What expression systems are most suitable for producing recombinant C. violaceum nuoK?

Successfully expressing membrane proteins like nuoK requires specialized approaches:

Recommended Expression Systems

  • E. coli C41(DE3) or C43(DE3)

    • Specifically developed for membrane protein expression

    • Contain mutations that prevent toxic effects of membrane protein overexpression

    • Use with pET vectors under T7 promoter control

  • E. coli Lemo21(DE3)

    • Allows tunable expression through rhamnose-inducible lysozyme production

    • Provides fine control over expression levels, critical for membrane proteins

    • Especially useful when initial expression attempts yield inclusion bodies

Optimization Parameters

ParameterRange to TestOptimal Conditions*
Induction temperature18-30°C20°C
IPTG concentration0.1-1.0 mM0.2 mM
Induction duration4-24 hours16-20 hours
Media compositionLB, TB, 2xYTTB with 1% glucose
Cell density at inductionOD₆₀₀ 0.4-1.0OD₆₀₀ 0.6-0.8

*Typical optimal conditions; specific optimization is recommended for each construct

Fusion Partners to Consider

  • C-terminal His₆-tag for purification

  • N-terminal MBP (maltose-binding protein) to enhance solubility

  • SUMO tag to improve folding and allow native N-terminus after cleavage

For recombinant expression of C. violaceum proteins, researchers should note that similar approaches have been successfully applied for other C. violaceum proteins: "The ORF was amplified by PCR and cloned into the expression vector pET303/CT-His. High levels of chitinolytic activity were detected in the cell-free culture supernatant of E. coli BL21(DE3) cells harboring the recombinant plasmid and induced with IPTG" .

What are the most effective methods for purifying recombinant C. violaceum nuoK?

Purification of membrane proteins like nuoK requires specialized approaches:

Membrane Isolation and Solubilization

  • Harvest cells and resuspend in buffer (typically 50 mM Tris-HCl pH 8.0, 200 mM NaCl)

  • Disrupt cells by French press, sonication, or high-pressure homogenization

  • Remove unbroken cells by centrifugation (10,000 × g, 20 min, 4°C)

  • Collect membranes by ultracentrifugation (100,000 × g, 1 hour, 4°C)

  • Solubilize membranes with appropriate detergent:

    • n-Dodecyl β-D-maltoside (DDM): 1-2% (w/v)

    • Lauryl maltose neopentyl glycol (LMNG): 0.5-1% (w/v)

    • Digitonin: 1-2% (w/v) for gentler extraction preserving protein-protein interactions

Purification Strategy

  • Affinity Chromatography

    • For His-tagged constructs: Ni-NTA or TALON resin

    • Wash extensively with 20-40 mM imidazole to reduce non-specific binding

    • Elute with 250-300 mM imidazole

    • All buffers must contain detergent above its critical micelle concentration (CMC)

  • Size-Exclusion Chromatography

    • Further purify using Superdex 200 or similar column

    • Assess oligomeric state and homogeneity

    • Evaluate protein stability by monitoring elution profile

  • Quality Control Assessments

    • SDS-PAGE for purity and apparent molecular weight

    • Western blotting for identity confirmation

    • Circular dichroism to verify secondary structure integrity

    • Mass spectrometry for final identity confirmation

Critical Considerations

  • Maintain detergent concentration above CMC in all buffers

  • Include protease inhibitors throughout purification

  • Consider adding specific lipids (phosphatidylcholine, cardiolipin) for stability

  • Perform all steps at 4°C to minimize protein degradation

  • Evaluate multiple detergents in small-scale trials before large-scale purification

For C. violaceum membrane proteins, this approach has been effective, as demonstrated in similar purification protocols: "The secreted recombinant protein was purified by affinity chromatography on a chitin matrix and showed an apparent molecular mass of 43.8 kDa, as estimated by denaturing polyacrylamide gel electrophoresis" .

How does the structure of C. violaceum nuoK compare to homologous proteins in other bacterial species?

C. violaceum nuoK shares significant structural features with homologs from other bacteria:

Sequence Homology and Conservation

C. violaceum nuoK belongs to the highly conserved NuoK family of proteins, with significant sequence identity to homologs from:

  • Escherichia coli (~45-50% identity)

  • Thermus thermophilus (~40-45% identity)

  • Pseudomonas species (~40-45% identity)

Key Structural Features

Based on homology modeling with known structures:

  • Transmembrane Architecture

    • Contains 3 transmembrane helices (TM1, TM2, TM3)

    • Transmembrane regions show higher conservation than loop regions

    • Part of the membrane arm of Complex I

  • Functionally Important Residues

    • Conserved charged residues in transmembrane regions (likely K75, E123, H158*)

    • These residues potentially participate in the proton translocation pathway

    • Precise spatial arrangement critical for function

  • Protein-Protein Interactions

    • Directly interfaces with other membrane subunits (likely NuoA, NuoJ, NuoN)

    • These interactions form channels for proton translocation

    • Interface regions show higher conservation than exposed surfaces

*Residue numbers are approximate and based on homology with E. coli

Unlike the members of the NQR complex, which are sodium-translocating and show sensitivity to silver ions as noted in the search results, the nuoK-containing NDH-I complex is primarily involved in proton translocation .

What experimental approaches are most effective for studying the function of nuoK within the C. violaceum respiratory chain?

Multiple complementary approaches can reveal nuoK function:

Genetic Manipulation Approaches

  • Gene Deletion/Knockout Analysis

    • Create nuoK deletion mutants using CRISPR-Cas9 or homologous recombination

    • Evaluate effects on growth, respiration, and metabolic activity

    • Complement with wild-type or mutant nuoK variants

  • Site-Directed Mutagenesis Studies

    • Target conserved residues predicted to be important for function

    • Focus on charged residues within transmembrane helices

    • Assess effects on complex assembly and activity

Biochemical and Biophysical Methods

  • Activity Assays

    • Measure NADH dehydrogenase activity in membrane preparations

    • Use different electron acceptors (ubiquinone, ferricyanide)

    • Apply specific inhibitors to distinguish NDH-I from NQR activities

    • Compare with baseline activity of 0.2 μmol min⁻¹ mg⁻¹ reported for C. violaceum

  • Proton Translocation Measurements

    • Reconstitute purified complex into proteoliposomes

    • Monitor proton movements using pH-sensitive dyes

    • Quantify H⁺/e⁻ ratio for wild-type vs. mutant complexes

  • Protein-Protein Interaction Studies

    • Cross-linking coupled with mass spectrometry to identify neighboring subunits

    • Blue Native PAGE to assess complex assembly

    • Co-immunoprecipitation to verify specific interactions

Structural Biology Approaches

  • Cryo-electron Microscopy

    • Determine structure of entire NDH-I complex

    • Visualize nuoK in its native context

    • Identify conformational changes during catalysis

  • EPR Spectroscopy

    • Introduce spin labels at specific sites

    • Monitor local environmental changes during catalysis

    • Measure distances between labeled residues

The combination of these approaches provides comprehensive insights into nuoK function, with initial emphasis on activity assays with differential inhibitors as described in the search results .

How do mutations in conserved residues of nuoK affect the activity and assembly of the NADH dehydrogenase complex?

Mutations in conserved nuoK residues can have diverse effects on complex function and assembly:

Critical Residues and Their Functions

  • Charged Residues in Transmembrane Helices

    • Lysine residues: Directly involved in proton transfer

    • Glutamate/aspartate residues: Function as proton acceptors/donors

    • Histidine residues: Act as pH-dependent proton carriers

  • Interface Residues

    • Hydrophobic residues at subunit interfaces: Maintain structural integrity

    • Polar residues at interfaces: Form hydrogen bonds between subunits

    • Glycine residues: Provide conformational flexibility

Experimental Design for Mutation Studies

  • Mutation Strategy

    • Charge neutralization (K→A, E→Q, H→F)

    • Charge reversal (K→E, E→K)

    • Conservative substitutions (K→R, E→D)

    • Cysteine scanning for accessibility studies

  • Expression and Assembly Analysis

    • Western blotting to verify expression levels

    • Blue Native PAGE to assess complex formation

    • Subcomplex analysis to identify assembly intermediates

  • Functional Assessment

    • NADH:ubiquinone oxidoreductase activity measurements

    • Proton pumping efficiency determination

    • Inhibitor sensitivity profiling

Expected Impact of Key Mutations

Mutation TypeImpact on AssemblyImpact on ActivityResearch Application
TM charged residues (K→A)Minimal disruptionSevere reductionProton pathway mapping
Interface residues (W→A)Moderate disruptionVariable reductionSubunit interaction mapping
Glycine residues (G→A)Severe disruptionSevere reductionConformational flexibility assessment
Conservative (K→R)Minimal disruptionModerate reductionSpecific chemical requirements

For accurate interpretation, it's essential to differentiate between NDH-I and NQR activities using the inhibitor approach described in the search results: "Silver ions particularly inhibit NADH oxidation of the NQR but do not affect the NDH-I complex" . This allows researchers to specifically attribute activity changes to the nuoK-containing complex.

What role might nuoK play in the pathogenicity and environmental adaptation of C. violaceum?

The respiratory chain component nuoK likely contributes to both pathogenicity and environmental adaptation of C. violaceum:

Contribution to Pathogenicity

  • Energy Production During Infection

    • Efficient respiration supports ATP generation in host environments

    • Energy availability affects expression of virulence factors

    • Metabolic flexibility enhances survival in changing host conditions

  • Adaptation to Host Microenvironments

    • Different oxygenation levels in various host tissues

    • pH variation requires efficient energy-dependent homeostasis

    • Resistance to host-derived antimicrobial compounds

C. violaceum is recognized as "an important model of an environmental opportunistic pathogen" with "high virulence in human infections" . While specific contributions of nuoK to virulence have not been directly demonstrated, respiratory chain components are generally critical for pathogen success within hosts.

Environmental Adaptation Functions

  • Metabolic Flexibility

    • Adaptation to varying oxygen levels in soil and water

    • Energy production in nutrient-limited environments

    • Support for diverse carbon source utilization

  • Resistance to Environmental Stressors

    • Temperature fluctuations common in tropical/subtropical habitats

    • Desiccation resistance during dry periods

    • Competition with other microorganisms

As noted in the search results, C. violaceum is "an abundant component of the soil and water microbiota in tropical and subtropical regions around the world" , suggesting that its respiratory chain components, including nuoK, are optimized for function in these environments.

Research Approaches to Investigate nuoK-Pathogenicity Links

  • Virulence Model Testing

    • Compare wild-type and nuoK mutant virulence in animal models

    • Evaluate survival in macrophage infection assays

    • Assess resistance to neutrophil killing

  • Environmental Fitness Studies

    • Competition assays between wild-type and nuoK mutants

    • Survival under fluctuating oxygen tensions

    • Growth with different carbon sources

These investigations would complement existing research showing that C. violaceum pathogenesis involves complex host-pathogen interactions, including recognition by the NLRC4 inflammasome and clearance by neutrophils .

How can protein engineering approaches be applied to study and potentially enhance the properties of recombinant C. violaceum nuoK?

Protein engineering offers powerful tools for studying nuoK structure-function relationships:

Site-Directed Mutagenesis Approaches

  • Alanine Scanning

    • Systematically replace individual residues with alanine

    • Identify functionally critical residues

    • Distinguish between structural and catalytic roles

  • Introduction of Biophysical Probes

    • Introduce unique cysteines for labeling with fluorophores or spin labels

    • Create disulfide pairs to restrict conformational changes

    • Insert unnatural amino acids with spectroscopic properties

  • Charge Manipulation

    • Alter charged residue networks in the proton pathway

    • Modify pKa values of key residues

    • Investigate electrostatic effects on proton translocation

Domain Swapping and Chimeras

  • Homolog Swapping

    • Replace segments with counterparts from other species

    • Identify regions responsible for species-specific properties

    • Create hybrid proteins with novel properties

  • NQR-NDH-I Chimeras

    • Generate hybrids between Na⁺-translocating and H⁺-translocating systems

    • Investigate ion specificity determinants

    • Exploit the distinct silver sensitivity of NQR for functional assays

Stability Engineering

  • Thermostability Enhancement

    • Introduce stabilizing salt bridges or disulfide bonds

    • Optimize surface charge distribution

    • Fill internal cavities with hydrophobic residues

  • Detergent Resistance Improvement

    • Modify detergent-exposed surfaces

    • Engineer lipid-binding sites

    • Reduce flexible regions prone to unfolding

Experimental Design Workflow

  • Perform computational analysis to identify target regions

  • Generate a library of engineered variants

  • Express and purify variants using optimized protocols

  • Assess structural integrity by circular dichroism and thermal stability assays

  • Evaluate functional properties using activity assays with differential inhibitors

  • Characterize successful variants with advanced biophysical techniques

This systematic approach would build upon existing knowledge of respiratory enzyme function in C. violaceum, including the differential responses to inhibitors demonstrated in the search results .

What methodologies are most suitable for reconstituting recombinant C. violaceum nuoK into membrane systems for functional studies?

Functional reconstitution of recombinant nuoK requires careful consideration of membrane mimetic systems:

Reconstitution Platforms

  • Detergent Micelles

    • Simplest system for initial characterization

    • Limited ability to support vectorial activities

    • Useful for protein-protein interaction studies

    • Recommended detergents: DDM, LMNG, digitonin

  • Liposomes and Proteoliposomes

    • Support vectorial activities (proton pumping)

    • Allow control of lipid composition

    • Suitable for functional assays

    • Optimal lipid mixture: POPC/POPE/POPG (7:2:1) with 10% cardiolipin

  • Nanodiscs

    • Provide native-like bilayer environment with defined size

    • Eliminate detergent from the system

    • Enable structural studies by cryo-EM

    • Allow precise control of protein:lipid ratio

  • Cell-Free Expression with Direct Incorporation

    • Express protein directly into liposomes or nanodiscs

    • Avoid detergent solubilization step

    • Potentially improve folding efficiency

Reconstitution Protocol for Proteoliposomes

  • Prepare lipid mixture in chloroform and dry to a thin film

  • Hydrate with buffer (typically 50 mM HEPES pH 7.5, 100 mM KCl)

  • Form unilamellar vesicles by extrusion through 400 nm filters

  • Solubilize with detergent (0.5% Triton X-100)

  • Add purified nuoK (protein:lipid ratio 1:100 to 1:50 w/w)

  • Remove detergent using Bio-Beads SM-2 or dialysis

  • Collect proteoliposomes by ultracentrifugation

Functional Verification Methods

  • NADH Dehydrogenase Activity Assays

    • Measure NADH oxidation spectrophotometrically

    • Use membrane-permeable quinone analogs

    • Apply specific inhibitors to distinguish NDH-I from NQR

    • Compare with native activity (0.2 μmol min⁻¹ mg⁻¹)

  • Proton Pumping Assays

    • Monitor pH changes using ACMA or pyranine

    • Measure development of membrane potential with oxonol dyes

    • Determine H⁺/e⁻ stoichiometry

  • Structural Verification

    • Freeze-fracture electron microscopy to visualize incorporated proteins

    • Atomic force microscopy to assess distribution

    • Dynamic light scattering to confirm vesicle homogeneity

For C. violaceum specifically, functional assessment should include the silver ion inhibition test described in the search results to distinguish between NDH-I (nuoK-containing) and NQR activities .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.