Recombinant Chromobacterium violaceum Probable intracellular septation protein A (CV_2929)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Chromobacterium violaceum Probable intracellular septation protein A (CV_2929) is a synthetic version of a native protein encoded by the CV_2929 gene in C. violaceum strain ATCC 12472. This protein belongs to the YciB family and is associated with bacterial cell envelope biogenesis and membrane integrity . Structurally, it is a multi-pass membrane protein localized to the inner membrane, playing a critical role in maintaining cellular structure during growth and division .

Functional Role

CV_2929 is implicated in:

  • Cell Envelope Biogenesis: Maintaining structural integrity of the bacterial membrane during growth and division .

  • Membrane Homeostasis: Regulating membrane fluidity and stability under environmental stress .

  • Regulatory Pathways: Potential involvement in signaling cascades linked to cell cycle control, though specific mechanisms remain under investigation .

No direct association with virulence or quorum sensing (e.g., cviI/cviR systems) has been established for CV_2929 .

Production and Purification

ParameterDetailsSource
Host OrganismsSaccharomyces cerevisiae (yeast) or Escherichia coli
Purity>85% (SDS-PAGE)
Storage BufferTris-based buffer with 50% glycerol (for -20°C storage)
Tag InformationDetermined during production (e.g., His-tag, SUMO-tag)

Recombinant CV_2929 is lyophilized and reconstituted in PBS for experimental use . Repeated freeze-thaw cycles are discouraged to preserve activity .

Applications and Research Implications

  • Basic Research: Studying bacterial cell division, membrane dynamics, and stress response pathways .

  • Diagnostic Tools: Potential use in ELISA assays for detecting C. violaceum or monitoring protein expression .

  • Therapeutic Targets: Exploring inhibitors targeting CV_2929 to disrupt membrane integrity in pathogenic bacteria, though current evidence is limited .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please communicate it to us. We will prioritize developing the specified tag.
Synonyms
yciB; CV_2929; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)
Target Names
CV_2929
Target Protein Sequence
MKFFTDLLPVLLFFGAYWLTRDMFVATGVAIAATAVMVAWAWFKHRKVDTMQWISLGLIV VLGGATLLLHDKHFIMWKPTVLYWVMGAGLLISEFAGKNGLRLMMGKQIEMPDPVWRKLT WAWSGFFAFMGALNLFVAYHFSEDVWVNFKLFGGMGLMLLFVIAQSLFLAKYIEEKK
Uniprot No.

Target Background

Function
This protein plays a vital role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links

KEGG: cvi:CV_2929

STRING: 243365.CV_2929

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is CV_2929 expression regulated in Chromobacterium violaceum?

While direct data on CV_2929 regulation is limited, research on C. violaceum gene regulation provides valuable insights. Many cellular processes in C. violaceum are regulated by quorum sensing (QS) systems, particularly the CviI/R system. The CviI protein produces N-acylhomoserine lactone signal molecules that bind to CviR, which then activates or represses target genes . Based on the growth-phase-dependent regulation observed in other C. violaceum proteins, CV_2929 expression might be influenced by population density through direct or indirect QS regulation. Experimental confirmation would require promoter-reporter fusion assays and expression analysis in wild-type and QS mutant backgrounds .

What methods are recommended for expressing recombinant CV_2929 protein?

For successful expression of recombinant CV_2929, a methodical approach is essential:

  • Vector selection: Use expression vectors with strong, inducible promoters (e.g., pET system for E. coli)

  • Host selection: E. coli strains BL21(DE3) or M15 are recommended based on successful expression of other C. violaceum proteins

  • Expression conditions:

    • Induction with 0.1-1.0 mM IPTG

    • Temperature optimization (18-37°C)

    • Growth in rich media (e.g., LB supplemented with appropriate antibiotics)

  • Protein extraction: Cell lysis using sonication or enzymatic methods followed by clarification

  • Purification strategy: Affinity chromatography using His-tag or other fusion tags

Cultivation conditions similar to those used for other C. violaceum proteins can be adopted: 30°C incubation with appropriate antibiotics (kanamycin 100 μg/ml or ampicillin 100 μg/ml) in LB medium .

How might CV_2929 interact with the Type VI Secretion System in Chromobacterium violaceum?

The Type VI Secretion System (T6SS) in C. violaceum plays a crucial role in interbacterial competition, with multiple VgrG proteins showing limited functional redundancy . While direct evidence of CV_2929 interaction with T6SS components is not established, several hypothetical interactions warrant investigation:

  • Temporal coordination: CV_2929-mediated septation might be coordinated with T6SS assembly or firing during specific growth phases

  • Spatial organization: CV_2929 could influence the subcellular localization of T6SS components

  • Regulatory crosstalk: Both systems might share regulatory inputs, particularly from the CviR QS system

Research approaches to investigate these potential interactions include:

  • Co-immunoprecipitation experiments with tagged CV_2929 and T6SS components

  • Fluorescence microscopy to track co-localization during different growth phases

  • Transcriptomic and proteomic profiling of CV_2929 and T6SS component expression

  • Phenotypic characterization of CV_2929 and T6SS double mutants

What role might CV_2929 play in Chromobacterium violaceum pathogenesis?

C. violaceum is generally non-pathogenic but can be extremely virulent in certain cases . The potential role of CV_2929 in pathogenesis could be explored through several approaches:

  • Virulence in animal models: Compare wild-type and CV_2929 mutant strains in established infection models like Caenorhabditis elegans or mouse models

  • Cell adherence and invasion: Examine if CV_2929 mutations affect bacterial interaction with host cells

  • Stress response contributions: Investigate whether CV_2929 plays a role in bacterial survival under host-imposed stresses

How does the quorum sensing system potentially regulate CV_2929 in comparison to other cell division proteins?

Based on research on QS regulation in C. violaceum, CV_2929 might be subject to complex regulatory control:

Regulatory FactorEffect on ViolaceinPotential Effect on CV_2929Experimental Evidence Needed
CviR + AHLPositive regulationPossible activationPromoter activity assays in WT vs ΔcviR
VioSNegative regulationUnknownExpression analysis in ΔvioS mutant
Cell densityComplex regulationPossible growth-phase dependent expressionTime-course expression analysis

The regulatory pattern may differ from that of violacein biosynthesis. While violacein shows positive regulation by CviR-AHL and negative regulation by VioS , CV_2929 might exhibit different regulatory dynamics. To determine this pattern, experiments should include:

  • Promoter-reporter fusion assays with CV_2929 promoter

  • Expression analysis in wild-type, ΔcviR, ΔcviI, and ΔvioS backgrounds

  • Chromatin immunoprecipitation to detect direct binding of regulators to the CV_2929 promoter

What is the optimal experimental design for studying CV_2929 function through gene knockout studies?

A comprehensive gene knockout study for CV_2929 should follow these methodological steps:

  • Mutant Construction:

    • Create a clean deletion mutant using allelic exchange methods

    • Generate complemented strains with CV_2929 under native and inducible promoters

    • Create fluorescently tagged versions for localization studies

  • Phenotypic Characterization:

    • Growth curves in various media and stress conditions

    • Cell morphology analysis using phase contrast and electron microscopy

    • Cell division dynamics using time-lapse microscopy

    • Septum formation visualization with specific dyes (e.g., FM4-64)

  • Controls and Variables:

    • Wild-type strain as positive control

    • Empty vector complementation as negative control

    • Growth conditions: temperature, media composition, growth phase

    • Stress conditions: antibiotics targeting cell wall, osmotic stress, pH stress

  • Data Collection and Analysis:

    • Quantitative metrics: growth rate, cell length, division time

    • Statistical analysis: minimum of three biological replicates with appropriate statistical tests

    • Image analysis: automated cell segmentation and measurement

This experimental design incorporates principles of controlled experimentation, ensuring reliable and valid findings by isolating the effects of CV_2929 knockout while controlling for extraneous variables .

What proteomics approaches are most suitable for identifying CV_2929 interaction partners?

For comprehensive identification of CV_2929 interaction partners, a multi-faceted proteomics approach is recommended:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Express CV_2929 with an affinity tag (His, FLAG, or TAP tag)

    • Perform crosslinking to capture transient interactions

    • Use gentle lysis conditions to preserve protein complexes

    • Conduct tandem mass spectrometry for protein identification

    • Include appropriate negative controls (tag-only, unrelated protein)

  • Proximity-Dependent Biotin Identification (BioID):

    • Fuse CV_2929 to a biotin ligase (BirA*)

    • Express in C. violaceum to biotinylate proximal proteins

    • Purify biotinylated proteins using streptavidin

    • Identify by mass spectrometry

  • Bacterial Two-Hybrid System:

    • Create fusion constructs of CV_2929 with split reporter domains

    • Screen against a C. violaceum genomic library

    • Validate positive interactions with co-immunoprecipitation

  • Data Analysis Protocol:

    • Filter against common contaminants

    • Apply statistical threshold for significance

    • Perform functional enrichment analysis

    • Validate top candidates with orthogonal methods (co-IP, fluorescence co-localization)

This integrated approach maximizes the likelihood of identifying both stable and transient interaction partners of CV_2929 in its native cellular context.

How can fluorescence microscopy be optimized to study CV_2929 localization during cell division?

Optimizing fluorescence microscopy for CV_2929 localization requires careful consideration of protein tagging, imaging parameters, and controls:

  • Protein Tagging Strategy:

    • C-terminal vs. N-terminal fusion determination based on predicted protein structure

    • Selection of appropriate fluorescent protein (sfGFP recommended based on successful use in C. violaceum )

    • Validation of fusion protein functionality through complementation tests

  • Microscopy Setup:

    • Use of agarose pads with growth medium for live cell imaging

    • Temperature-controlled microscope stage set to 30°C (optimal for C. violaceum)

    • Time-lapse imaging with appropriate intervals (3-5 minutes) to capture division dynamics

    • Z-stack acquisition to ensure complete cell visualization

  • Co-Visualization Approach:

    • Membrane staining with FM4-64 to visualize septum formation

    • DNA staining with DAPI to track chromosome segregation

    • Co-expression of known division proteins (e.g., FtsZ) with alternative fluorophores

  • Image Analysis Protocol:

    • Deconvolution to improve signal-to-noise ratio

    • Quantitative analysis of protein localization relative to cell landmarks

    • Kymograph generation to visualize dynamics over time

    • Cell segmentation and fluorescence intensity profiling along the cell length

This approach, similar to that used for visualizing T6SS components in C. violaceum , will provide spatial and temporal information about CV_2929 localization during the bacterial cell cycle.

How should researchers interpret contradictory results between in vitro and in vivo studies of CV_2929?

When confronted with contradictory results between in vitro and in vivo studies of CV_2929, researchers should follow this systematic approach to resolution:

  • Source Evaluation:

    • Examine methodological differences between studies (protein preparation, buffer conditions, cellular context)

    • Assess physiological relevance of in vitro conditions compared to the bacterial cytoplasm

    • Consider post-translational modifications present in vivo but absent in vitro

  • Reconciliation Strategies:

    • Develop intermediate models that bridge in vitro simplicity with in vivo complexity

    • Utilize reconstitution experiments with gradually increasing complexity

    • Employ biochemical approaches in cellular extracts as a middle ground

  • Additional Validation Methods:

    • Structural studies to identify conformation differences between purified and cellular protein

    • In-cell NMR or FRET to observe protein behavior in the native environment

    • Single-molecule tracking to monitor dynamic behavior in living cells

  • Integration Framework:

    • Construct a hypothesis that accommodates both datasets by considering condition-dependent behavior

    • Design experiments specifically to test this unified hypothesis

    • Consider regulatory factors present in vivo that may alter protein function

This approach recognizes that both in vitro and in vivo studies provide valuable but partial insights, and integration of multiple lines of evidence is necessary for complete understanding of CV_2929 function.

What statistical approaches are appropriate for analyzing CV_2929 mutant phenotypes?

  • Exploratory Data Analysis:

    • Data visualization through histograms, box plots, and scatter plots

    • Normality testing (Shapiro-Wilk test) to determine appropriate statistical tests

    • Outlier identification and handling strategy

  • Comparative Statistical Tests:

    • For normally distributed data: t-tests (two conditions) or ANOVA (multiple conditions)

    • For non-parametric data: Mann-Whitney U test or Kruskal-Wallis test

    • Post-hoc testing (e.g., Tukey's HSD) for multiple comparisons

  • Effect Size Calculation:

    • Cohen's d for parametric data

    • Cliff's delta for non-parametric data

    • 95% confidence intervals for all effect sizes

  • Advanced Analytical Approaches:

    • Mixed-effects models for experiments with nested or repeated measures

    • Multivariate analysis for experiments with multiple dependent variables

    • Principal component analysis for dimension reduction in complex datasets

  • Minimum Reporting Standards:

    • Sample sizes and power calculations

    • Exact p-values rather than significance thresholds

    • Complete descriptive statistics (mean, median, standard deviation)

    • Specification of statistical tests used and software/packages

This comprehensive statistical framework ensures rigorous analysis of CV_2929 phenotypic data, following principles of experimental design in research to establish reliable cause-and-effect relationships .

How can researchers distinguish between direct and indirect effects of CV_2929 on cell division processes?

Distinguishing between direct and indirect effects of CV_2929 on cell division requires a multi-faceted experimental approach:

  • Temporal Resolution Analysis:

    • High-resolution time-lapse microscopy to establish the sequence of events

    • Inducible expression systems to observe immediate vs. delayed consequences

    • Correlation of CV_2929 localization with specific division events

  • Protein-Protein Interaction Hierarchy:

    • Systematic analysis of protein complex assembly with and without CV_2929

    • In vitro reconstitution of minimal interaction systems

    • Binding affinity measurements to determine primary vs. secondary interactions

  • Genetic Interaction Mapping:

    • Epistasis analysis with other cell division genes

    • Suppressor screening to identify genes that can bypass CV_2929 defects

    • Synthetic genetic array to create a network of genetic interactions

  • Direct Biochemical Testing:

    • In vitro activity assays for predicted enzymatic functions

    • Structural studies to identify interaction domains and binding sites

    • Site-directed mutagenesis to disrupt specific functions while preserving others

This approach parallels methods used to study regulatory relationships in C. violaceum, such as the analysis of VioS-mediated regulation of violacein biosynthesis, where researchers distinguished direct effects on promoter activity from indirect effects through the QS system .

What strategies can address poor expression of recombinant CV_2929?

When facing poor expression of recombinant CV_2929, researchers should implement this systematic troubleshooting protocol:

  • Expression System Optimization:

    • Test multiple expression vectors with different promoter strengths

    • Evaluate various E. coli strains (BL21, Rosetta for rare codons, C41/C43 for membrane proteins)

    • Consider C. violaceum-based expression systems for native folding environment

  • Expression Condition Optimization:

    • Temperature reduction (37°C to 18-25°C) to improve protein folding

    • Induction strength modulation (IPTG concentration 0.01-1.0 mM)

    • Media composition adjustment (defined vs. rich media)

    • Growth phase optimization (mid-log vs. late-log induction)

  • Protein Engineering Approaches:

    • Fusion with solubility-enhancing tags (MBP, SUMO, Thioredoxin)

    • Domain expression instead of full-length protein

    • Codon optimization for expression host

    • Removal of predicted problematic regions

  • Expression Monitoring Protocol:

    • Western blot analysis of whole-cell lysates, soluble, and insoluble fractions

    • Time-course sampling to determine optimal harvest time

    • RT-qPCR to confirm transcription

This troubleshooting framework draws on successful expression strategies for other C. violaceum proteins, including the use of M15 E. coli strain and appropriate antibiotic selection for plasmid maintenance .

How should researchers address conflicting results from different CV_2929 knockout construction methods?

When different knockout construction methods yield conflicting results for CV_2929, researchers should implement this resolution strategy:

  • Methodological Comparison:

    • Document exact differences between knockout strategies (insertion vs. deletion, marker selection)

    • Evaluate potential polar effects on downstream genes

    • Assess likelihood of compensatory mutations or suppressors

  • Validation Protocol:

    • Confirm genotype by PCR, sequencing, and Southern blot

    • Verify transcript absence by RT-PCR and RNA-seq

    • Confirm protein absence by western blot or mass spectrometry

    • Ensure clean genetic background through whole-genome sequencing

  • Phenotypic Reconciliation:

    • Compare growth conditions across experiments

    • Standardize phenotypic assays and measurement techniques

    • Consider strain background effects (lab-adapted vs. clinical isolates)

  • Definitive Resolution Approaches:

    • Generate new mutants using CRISPR-Cas9 for precise, scarless deletion

    • Create conditional knockdowns using CRISPRi or antisense RNA

    • Perform complementation with native and heterologous promoters

  • Documentation Standards:

    • Report all methods attempted and their outcomes

    • Describe growth conditions in detail

    • Provide raw data alongside analyzed results

This approach is informed by experiences with transposon mutagenesis in C. violaceum, where different insertion sites in the same gene (e.g., vioS) resulted in varying phenotypic strengths .

What approaches can resolve difficulties in detecting CV_2929 protein-protein interactions in vivo?

Detection of CV_2929 protein-protein interactions in vivo can be challenging. This comprehensive troubleshooting strategy addresses common obstacles:

  • Crosslinking Optimization:

    • Test multiple crosslinkers (formaldehyde, DSP, photo-activatable)

    • Optimize crosslinking conditions (concentration, time, temperature)

    • Employ two-step crosslinking for capturing weak or transient interactions

  • Lysis Condition Refinement:

    • Test detergent panels (mild to strong) for optimal solubilization

    • Adjust buffer composition (salt concentration, pH, stabilizing agents)

    • Consider specialized extraction protocols for membrane-associated complexes

  • Alternative Detection Methods:

    • Förster Resonance Energy Transfer (FRET) for live-cell interaction detection

    • Split-protein complementation assays (e.g., split-GFP, NanoBiT)

    • Proximity ligation assay for fixed cell samples

    • Co-localization studies with super-resolution microscopy

  • Controlled Expression Systems:

    • Inducible promoters to prevent toxicity

    • Dual-expression vectors for stoichiometric production

    • Native promoter expression to maintain physiological levels

This approach builds on successful protein interaction detection methods employed in C. violaceum research, such as the coimmunoprecipitation techniques used to study VgrG protein interactions in the T6SS system .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.