Recombinant Chromobacterium violaceum Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function of Lgt

Lgt catalyzes the transfer of a diacylglyceryl group from phosphatidylglycerol to the conserved cysteine residue of prolipoproteins, anchoring them to the membrane. This modification is essential for:

  • Membrane localization of lipoproteins .

  • Outer membrane integrity and antibiotic resistance in Gram-negative bacteria .

  • Virulence factor secretion in pathogens .

Mechanism:

  1. Recognition of the lipobox motif ([LVI][ASTVI][GAS]C) in prolipoproteins.

  2. Diacylglyceryl transfer via a thioether bond to cysteine +1 .

  3. Subsequent processing by LspA (signal peptidase II) and Lnt (N-acyl transferase) in Gram-negative bacteria .

Genomic Context in C. violaceum

  • C. violaceum’s genome shares homology with Ralstonia solanacearum and Pseudomonas aeruginosa, suggesting conserved lipoprotein biogenesis pathways .

  • A putative lgt gene likely exists, given its universal presence in bacterial genomes, but experimental validation is absent in the provided data.

Implications for C. violaceum Physiology

Though direct studies on C. violaceum Lgt are lacking, its lipoproteins are implicated in:

  • Violacein Biosynthesis: AHL-dependent quorum sensing regulates violacein production, which is linked to virulence and antimicrobial activity .

  • Pathogenicity: Lipoproteins in C. violaceum likely contribute to host immune evasion, as seen in E. coli and Acinetobacter baumannii .

  • Antibiotic Resistance: Inhibiting Lgt in E. coli disrupts outer membrane integrity, increasing antibiotic susceptibility . Similar vulnerabilities may exist in C. violaceum.

Research Gaps and Opportunities

  1. Recombinant Lgt Studies: No data exist on C. violaceum Lgt expression, purification, or biochemical characterization. Cloning and functional assays (e.g., diacylglyceryl transfer activity) are needed.

  2. Inhibitor Development: Lgt inhibitors (e.g., G2823, G2824) show bactericidal activity in E. coli and A. baumannii . These could be tested against C. violaceum to assess cross-species efficacy.

  3. Genetic Knockout Models: Creating lgt deletion mutants in C. violaceum would clarify its role in violacein production and virulence.

Comparative Analysis of Lgt Inhibition

InhibitorTarget SpeciesIC₅₀ (μM)Bactericidal EffectResistance Mechanism
G2823E. coli0.93YesIndependent of lpp
G2824E. coli0.18YesIndependent of lpp
GlobomycinPseudomonas spp.0.24YesBinds conserved LspA site

C. violaceum’s Lgt may exhibit similar sensitivity to these compounds.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have a specific format preference, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please communicate it to us, and we will prioritize developing it as per your request.
Synonyms
lgt; CV_1276; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)
Target Names
lgt
Target Protein Sequence
MLIHPQFDPVAIHLGPLAVHWYGLMYLLGFALFLTMGKYRLKNGNDVLTVPQLDDMLMYG AVGVVVGGRLGEVLFYQPGYYFSHPLEIFMVWKGGMSFHGGFLGVLIAVAIYGRKVGRGF WQLTDFVAPLVPLGLAAGRVGNFINGELWGRVASPELPWAMLFPQARMEDIAEAQQSADL MNMLMQYGGLLRHPSQLYEFALEGIVLFGALWIYSAKPRATGKVSALFLIGYGLARFVSE YFRNPDAGIFGKSDVISMGQWLSLPMIVIGVALLVFFGRRKQG
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) from Chromobacterium violaceum catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: cvi:CV_1276

STRING: 243365.CV_1276

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein Diacylglyceryl Transferase (Lgt) and what is its role in Chromobacterium violaceum?

Prolipoprotein diacylglyceryl transferase (Lgt) is a critical enzyme that catalyzes the first step in bacterial lipoprotein biosynthesis. In Chromobacterium violaceum, as in other Gram-negative bacteria, Lgt transfers the diacylglyceryl moiety from phosphatidylglycerol to the conserved cysteine residue in the lipobox motif of prolipoproteins, forming a thioether bond. This modification is essential for proper anchoring of lipoproteins to the bacterial membrane. The reaction results in the release of glycerol phosphate as a byproduct, which can be used to measure enzymatic activity . Lgt function is critical for maintaining the integrity of the outer membrane in C. violaceum, similar to its role in other Gram-negative bacteria like E. coli and Acinetobacter baumannii .

How does the expression and purification of recombinant C. violaceum Lgt differ from other bacterial Lgt proteins?

The expression and purification of recombinant C. violaceum Lgt follows protocols similar to those established for E. coli Lgt but requires optimization for the specific characteristics of C. violaceum proteins. C. violaceum has distinct growth requirements and regulatory systems that may affect recombinant protein expression. For instance, C. violaceum is a free-living organism found in soil and water environments, producing a characteristic purple pigment called violacein . This pigment production, regulated by quorum sensing mechanisms, may interfere with protein purification protocols if not accounted for in the experimental design.

When expressing recombinant C. violaceum Lgt, researchers typically use E. coli-based expression systems with temperature-inducible or IPTG-inducible promoters. Purification often involves metal affinity chromatography for His-tagged recombinant proteins, followed by size exclusion chromatography to obtain pure protein. The purification buffer composition is critical for maintaining Lgt stability, typically containing appropriate detergents to preserve the membrane protein structure.

What are the optimal growth conditions for expressing recombinant C. violaceum Lgt?

The expression of recombinant C. violaceum Lgt is influenced by several growth parameters. Based on research with C. violaceum strains, optimal expression conditions typically include:

  • Temperature: Growth at 28-30°C appears optimal for C. violaceum protein expression, as this matches its environmental preference.

  • Media composition: Luria-Bertani (LB) medium is commonly used, though the media can affect quorum sensing mechanisms in C. violaceum .

  • Aeration: Shaking speed between 150-225 rpm provides adequate aeration for C. violaceum growth, which is important as it is a facultative anaerobe .

  • Induction parameters: For recombinant expression in E. coli hosts, IPTG concentration (typically 0.1-1.0 mM) and induction time (4-16 hours) need optimization.

  • Cell density: High inoculation density (around 20% of culture volume) has been shown to affect C. violaceum phenotypes and may influence protein expression .

The expression of membrane proteins like Lgt often benefits from lower induction temperatures (16-20°C) to prevent inclusion body formation and promote proper folding.

What is the relationship between Lgt function and quorum sensing mechanisms in C. violaceum?

The relationship between Lgt function and quorum sensing (QS) in C. violaceum represents an intriguing research area where direct evidence is limited but conceptual connections exist. C. violaceum employs an N-acylhomoserine lactone (AHL) QS system encoded by the cviI and cviR genes, which regulates the production of violacein and other phenotypes . This system functions differently in various C. violaceum strains, with strain ATCC31532 producing C6-HSL and strain ATCC12472 producing C10-HSL as primary signaling molecules .

The potential interactions between Lgt and QS systems may occur at multiple levels:

  • Membrane integrity: Lgt is essential for proper lipoprotein anchoring and outer membrane stability, which could affect the diffusion or transport of AHL signaling molecules.

  • Signal molecule processing: Some lipoproteins may participate in processing or responding to QS signals.

  • Regulatory overlaps: The VioS protein negatively regulates violacein biosynthesis without affecting the CviI/R system directly , suggesting complex regulatory networks where Lgt-dependent lipoproteins might play roles.

Experimental approaches to investigate this relationship would involve creating conditional Lgt mutants in C. violaceum and examining the effects on QS-regulated phenotypes, particularly violacein production and protease/chitinase activities known to be under QS control.

What structural features of C. violaceum Lgt could be exploited for the development of specific inhibitors?

Developing specific inhibitors for C. violaceum Lgt would require detailed knowledge of its structural features, particularly those that differentiate it from human enzymes. While crystal structures of C. violaceum Lgt are not yet available in the literature, insights can be drawn from related bacterial Lgt structures and inhibitor studies.

Key structural features likely to be important for inhibitor design include:

  • Phosphatidylglycerol binding site: Inhibitors targeting this conserved site might compete with the natural substrate.

  • Prolipoprotein recognition domain: Peptide-based inhibitors mimicking the lipobox motif could interfere with substrate binding.

  • Catalytic residues: Molecules that interact with catalytic residues could directly inhibit the diacylglyceryl transfer reaction.

Research on E. coli Lgt inhibitors has identified compounds that potently inhibit Lgt biochemical activity in vitro (IC₅₀ values of 0.18-0.93 μM) and display bactericidal activity against wild-type strains . These compounds (identified as G9066, G2823, and G2824) provide starting points for developing C. violaceum Lgt inhibitors.

Interestingly, unlike inhibitors of other lipoprotein biosynthesis steps, resistance to Lgt inhibitors cannot be achieved simply by deleting the major outer membrane lipoprotein (lpp) . This suggests Lgt may be less vulnerable to common resistance mechanisms, making it an attractive antibacterial target.

How can Lgt enzymatic activity be measured in vitro for recombinant C. violaceum Lgt?

The enzymatic activity of recombinant C. violaceum Lgt can be measured through several complementary approaches:

Glycerol Phosphate Release Assay:
This assay measures the release of glycerol phosphate, a byproduct of the Lgt-catalyzed reaction. For E. coli Lgt, researchers have developed a coupled luciferase reaction to detect released glycerol-3-phosphate . The assay components include:

  • Purified recombinant Lgt

  • Phosphatidylglycerol substrate

  • Synthetic peptide substrate (e.g., derived from Pal lipoprotein, containing the conserved cysteine residue)

  • Detection system for glycerol phosphate

Table 1: Standard Assay Conditions for Lgt Activity Measurement

ComponentConcentrationNotes
Recombinant Lgt0.5-5 μMPurified in detergent micelles
Phosphatidylglycerol50-200 μMNatural substrate
Peptide substrate10-100 μMContaining lipobox motif (e.g., Pal-IAAC)
Buffer-Typically HEPES or Tris, pH 7.4-8.0
Detergent0.1-0.5%To maintain Lgt solubility (e.g., DDM)
Temperature30-37°COptimized for enzyme activity
Incubation time30-60 minTime course studies recommended

Thin Layer Chromatography (TLC):
This approach can directly visualize the transfer of radiolabeled diacylglyceryl from phosphatidylglycerol to peptide substrates.

Mass Spectrometry:
Mass spectrometry can confirm the addition of the diacylglyceryl moiety to peptide substrates, providing precise molecular characterization of reaction products.

Control reactions should include a negative control with mutated peptide substrate (e.g., cysteine to alanine substitution) that cannot accept the diacylglyceryl modification .

What genetic approaches can be used to study Lgt function in C. violaceum?

Several genetic approaches can be employed to study Lgt function in C. violaceum:

Inducible Expression Systems:
Creating strains with inducible lgt expression allows for controlled depletion of Lgt to study its physiological roles. This approach has been successful with E. coli Lgt and could be adapted for C. violaceum using:

  • Arabinose-inducible (PBAD) or tetracycline-responsive promoters

  • CRISPR interference (CRISPRi) for conditional knockdown

  • Degron-based systems for controlled protein degradation

Complementation Studies:
These involve expressing recombinant C. violaceum Lgt in lgt-depleted strains to verify function and study structure-function relationships through site-directed mutagenesis of key residues.

Reporter Systems:
Developing reporter systems for monitoring lipoprotein processing in C. violaceum could involve:

  • Western blot analysis to detect unprocessed prolipoproteins (as demonstrated for E. coli Lpp)

  • Fluorescent reporter fusions to track lipoprotein localization

  • Transcriptional reporters to monitor stress responses triggered by Lgt depletion

Biochemical Validation:
Confirming specific phenotypes of genetic manipulations through:

  • SDS fractionation to separate peptidoglycan-associated proteins from soluble proteins

  • Membrane permeability assays to assess outer membrane integrity

  • Serum sensitivity tests to evaluate bacterial vulnerability to complement-mediated killing

How can researchers assess the impact of Lgt inhibition on C. violaceum membrane integrity and virulence?

Assessing the impact of Lgt inhibition on C. violaceum membrane integrity and virulence requires multiple complementary approaches:

Membrane Integrity Assays:

  • Outer Membrane Permeability: Using hydrophobic antibiotics (rifampicin, novobiocin) or dyes (N-phenyl-1-naphthylamine) to assess barrier function. Lgt inhibition should increase permeability, similar to effects observed in E. coli .

  • Membrane Vesicle Formation: Quantifying and characterizing outer membrane vesicles produced following Lgt inhibition using transmission electron microscopy and proteomics.

  • Lipid Distribution Analysis: Using fluorescent lipid probes to track changes in membrane organization following Lgt inhibition.

Virulence Assessment:

  • Caenorhabditis elegans Infection Model: C. violaceum virulence can be assessed using C. elegans as previously described . Researchers can compare wild-type and Lgt-inhibited C. violaceum for mortality rates and colonization levels.

  • Serum Sensitivity Assays: Measuring bacterial survival in human or animal serum to assess complement resistance, which is typically reduced following Lgt inhibition .

  • Biofilm Formation: Quantifying biofilm formation capacity through crystal violet staining or confocal microscopy.

  • Quorum Sensing-Regulated Phenotypes: Monitoring violacein production, protease activity, and chitinase production, which are under quorum sensing control in C. violaceum .

Table 2: Impact of Lgt Inhibition on Bacterial Phenotypes

PhenotypeExpected OutcomeMeasurement Method
Membrane permeabilityIncreasedAntibiotic sensitivity assays
Lipoprotein processingAccumulation of prolipoproteinsWestern blot analysis
Peptidoglycan crosslinkingReducedHPLC analysis of peptidoglycan
Violacein productionVariable (depends on QS relationships)Spectrophotometric quantification
Serum resistanceDecreasedCFU enumeration after serum exposure
Biofilm formationReducedCrystal violet staining

What are the major challenges in working with recombinant C. violaceum Lgt?

Working with recombinant C. violaceum Lgt presents several significant challenges:

  • Membrane Protein Expression: As an integral membrane protein, Lgt is difficult to express in soluble, active form. The hydrophobic nature of membrane proteins often leads to inclusion body formation, misfolding, or toxicity to the expression host. Optimizing detergent conditions for extraction and purification remains challenging.

  • Enzymatic Assay Complexity: Developing reliable assays for Lgt activity requires both membrane-bound substrates (phosphatidylglycerol) and peptide substrates in mixed micelle systems, creating potential issues with substrate presentation and product detection.

  • Violacein Interference: The production of violacein pigment by C. violaceum can interfere with spectrophotometric assays and protein purification procedures . This may necessitate working with non-pigmented mutants or developing specialized purification protocols.

  • Strain-Specific Variations: Different C. violaceum strains show significant variations in quorum sensing systems and regulatory networks , which may affect Lgt expression and function. Researchers must carefully select and characterize their working strain.

  • Genetic Manipulation Difficulties: While genetic tools for C. violaceum exist, they are less developed than those for model organisms like E. coli, potentially complicating genetic studies of Lgt function.

How might the function of Lgt in C. violaceum differ between environmental and host-associated conditions?

The dual lifestyle of C. violaceum as both an environmental bacterium and occasional pathogen suggests that Lgt function might be differentially regulated under these distinct conditions:

In environmental settings (soil and water), C. violaceum experiences:

  • Fluctuating nutrient availability

  • Competition within microbial communities

  • Varying temperatures and pH conditions

  • Potential predation by protozoa

Under these conditions, Lgt-mediated lipoprotein processing likely supports:

  • Outer membrane stability against environmental stresses

  • Efficient nutrient acquisition

  • Production of antimicrobials like violacein that provide competitive advantages in mixed microbial communities

In contrast, during host infection, C. violaceum encounters:

  • Host immune defenses

  • Serum complement activity

  • Antimicrobial peptides

  • Nutrient restriction

Here, Lgt function may be crucial for:

  • Resistance to serum killing, similar to observations in E. coli

  • Evasion of immune recognition

  • Regulation of virulence factor expression

  • Adaptation to host-specific environmental conditions

Research examining Lgt expression and activity under different growth conditions could reveal condition-specific roles. For instance, analyzing transcriptomic and proteomic changes in C. violaceum grown in soil-mimicking media versus serum-containing media could identify condition-specific requirements for Lgt function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.