Recombinant Chromobacterium violaceum Undecaprenyl-diphosphatase 1 (uppP1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
We determine the tag type during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP1; bacA1; upk1; CV_1327; Undecaprenyl-diphosphatase 1; Bacitracin resistance protein 1; Undecaprenyl pyrophosphate phosphatase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)
Target Names
uppP1
Target Protein Sequence
MLFHSLIMGLVEGITEFLPISSTGHLILTGDLLGFLDKEKRDVYEIFIQLGAMLAVVWEY RRKIGHTVAGAVRPGGERNLLLGIVIAFIPAAVAGLLFSKQIKAVLFNPVCVAIAFIVGG LIILWAEKREHKVAVETVDDLSLKDALKVGLCQCLALIPGTSRSGATIIGGLFLGLSRKA ATEFSFFLGIPTLGAASLYSLIKHRDALSADDIGVFAVGFIASFVFAFLAIRALLRFIST HSFAVFAWYRIAFGLIVLGTWWSGLVNWSA
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links

KEGG: cvi:CV_1327

STRING: 243365.CV_1327

Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Chromobacterium violaceum and its significance in research?

Chromobacterium violaceum is a Gram-negative bacterium belonging to the Neisseriaceae family of Betaproteobacteria. It is predominantly found in soil and freshwater environments in tropical and subtropical regions worldwide. Despite its primarily saprophytic, free-living lifestyle, C. violaceum has emerged as an important model of an environmental opportunistic pathogen that can cause severe infections in humans and other animals .

The bacterium is particularly notable for producing violacein, a purple pigment with demonstrated activity against bacteria, fungi, protozoa, viruses, and tumor cells. This characteristic has positioned C. violaceum as a bacterium with significant biotechnological potential . Recent genome sequencing efforts have further enhanced our understanding of C. violaceum's pathogenicity mechanisms, revealing the presence of multiple virulence factors, including two type III secretion systems (T3SSs) .

What is the function of uppP1 in bacterial cells?

Undecaprenyl-diphosphatase 1 (uppP1) catalyzes the dephosphorylation of undecaprenyl pyrophosphate to form undecaprenyl phosphate. This reaction is essential for the recycling of the lipid carrier used in cell wall biosynthesis. The complete amino acid sequence of C. violaceum uppP1 reveals a membrane protein with multiple transmembrane segments, consistent with its function at the bacterial membrane interface .

The enzymatic activity occurs within the complex environment of the bacterial membrane, where uppP1 plays a critical role in maintaining the pool of available undecaprenyl phosphate carriers. Methodologically, studying this function requires either reconstitution of the purified protein in artificial membrane systems or careful design of whole-cell assays that can distinguish uppP1 activity from other phosphatases within the bacterial cell.

How is uppP1 related to antibiotic resistance?

The alternative name "Bacitracin resistance protein 1" highlights uppP1's significant role in antibiotic resistance . Bacitracin is an antibiotic that functions by binding to undecaprenyl pyrophosphate, preventing its dephosphorylation and consequently inhibiting cell wall biosynthesis. By rapidly dephosphorylating undecaprenyl pyrophosphate, uppP1 reduces the available target for bacitracin, thereby conferring resistance.

To study this resistance mechanism, researchers typically employ bacitracin susceptibility assays with wild-type and uppP1 knockout or overexpression strains. Methodologically, this involves:

  • Generating gene deletion or overexpression constructs

  • Transforming these constructs into C. violaceum

  • Determining minimum inhibitory concentrations (MICs) of bacitracin

  • Complementation studies to confirm that altered susceptibility is specifically due to uppP1

What are the structural characteristics of uppP1?

The uppP1 protein from C. violaceum consists of 270 amino acids with multiple predicted transmembrane domains . The amino acid sequence (as provided in the product information) suggests a highly hydrophobic protein with multiple membrane-spanning regions, consistent with its role as an integral membrane protein.

Methodologically, structural characterization of membrane proteins like uppP1 presents significant challenges. Approaches include:

  • Hydropathy analysis of the amino acid sequence to predict transmembrane domains

  • Recombinant expression with fusion tags that aid in solubilization and purification

  • Reconstitution into membrane mimetics (detergent micelles, nanodiscs, or liposomes)

  • Structural determination through X-ray crystallography or cryo-electron microscopy, though these remain challenging for membrane proteins

How does uppP1 relate to C. violaceum pathogenicity?

While direct evidence linking uppP1 to C. violaceum pathogenicity is not explicitly detailed in the available literature, we can analyze its potential role in the context of C. violaceum's known virulence mechanisms. C. violaceum possesses two Type III Secretion Systems (T3SSs) encoded by pathogenicity islands Cpi-1/1a and Cpi-2, with Cpi-1/1a being essential for virulence in a mouse model of infection .

Cell wall integrity and modification mechanisms, potentially involving uppP1, could interact with these virulence systems. The Cpi-1/1a T3SS is required for the secretion of effector proteins and is recognized by the NLRC4 inflammasome from innate immune cells . Research methods to investigate potential connections between uppP1 and pathogenicity might include:

  • Generation of uppP1 knockout mutants to assess virulence in infection models

  • Transcriptomic analysis to determine if uppP1 expression changes during infection

  • Evaluation of potential interactions between uppP1 activity and T3SS function

  • Assessment of cell wall modifications during host-pathogen interactions that might involve uppP1

What experimental approaches can be used to study uppP1 enzymatic activity?

Studying the enzymatic activity of membrane-bound phosphatases like uppP1 requires specialized techniques to maintain protein function outside its native environment. Methods include:

  • In vitro reconstitution assays:

    • Purify recombinant uppP1 and reconstitute in artificial membrane systems (liposomes, nanodiscs)

    • Supply radiolabeled or fluorescently-labeled undecaprenyl pyrophosphate substrate

    • Detect product (undecaprenyl phosphate) formation using chromatography or electrophoresis

  • Whole-cell assays:

    • Express uppP1 in a heterologous host lacking endogenous activity

    • Supply modified substrate that can penetrate the membrane

    • Measure dephosphorylation using colorimetric phosphate detection methods

  • Bacitracin resistance assays:

    • Correlate enzymatic activity with functional resistance

    • Compare MIC values with protein expression levels or with variant proteins

These assays can be adapted to determine kinetic parameters, test potential inhibitors, or assess the effects of amino acid substitutions on uppP1 function.

How does the uppP1 gene distribution compare across the Chromobacterium genus?

Based on genomic analyses of the Chromobacterium genus, we can infer that core cellular functions, including cell wall biosynthesis enzymes like uppP1, are likely conserved across species. While not explicitly mentioned in the search results, the genomic distribution of pathogenicity islands has been analyzed across 22 Chromobacterium species/strains .

The Cpi-1/1a T3SS pathogenicity island is widespread throughout the Chromobacterium genus, with its absence noted only in C. piscinae . Given that cell wall biosynthesis is essential for bacterial survival, the uppP1 gene is likely present in all Chromobacterium species, though potentially with sequence variations reflecting evolutionary adaptations.

Methodologically, researchers interested in uppP1 distribution might:

  • Perform comparative genomic analyses across all sequenced Chromobacterium species

  • Use PCR-based approaches to detect uppP1 homologs in environmental isolates

  • Create phylogenetic trees based on uppP1 sequences to understand evolutionary relationships

  • Correlate uppP1 sequence variations with potential functional differences

What challenges exist in expressing and purifying recombinant uppP1?

As a membrane protein with multiple transmembrane domains, uppP1 presents significant challenges for recombinant expression and purification. These challenges include:

  • Protein folding and toxicity:

    • Overexpression of membrane proteins often leads to misfolding and toxicity to host cells

    • Expression in specialized strains (C41/C43 E. coli) designed for membrane proteins

    • Use of weaker promoters or inducible systems to control expression levels

  • Solubilization and purification:

    • Selection of appropriate detergents that maintain protein structure and function

    • Optimization of detergent concentration to prevent aggregation or denaturation

    • Use of fusion tags (MBP, SUMO) that enhance solubility and facilitate purification

  • Functional reconstitution:

    • Transfer from detergent micelles to suitable membrane mimetics

    • Verification of proper folding and activity following purification

    • Development of robust activity assays compatible with the reconstitution system

Successful expression might employ systems like E. coli with appropriate fusion tags, followed by affinity chromatography in the presence of carefully selected detergents .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.