Recombinant Chromobacterium violaceum UPF0060 membrane protein CV_3485 (CV_3485)

Shipped with Ice Packs
In Stock

Description

Introduction to Chromobacterium violaceum

Chromobacterium violaceum is a Gram-negative beta-proteobacterium commonly found in tropical and subtropical environments, inhabiting both water and soil . This bacterium is known for its ability to cause opportunistic infections in humans, which can lead to high mortality rates . C. violaceum is also notable for producing violacein, a purple pigment with antimicrobial and antiparasitic properties .

Virulence Factors and Infection Mechanisms

C. violaceum employs several virulence determinants to establish infections. One key factor is the Cpi1/1a type III secretion system, which facilitates hepatocyte invasion and activates the innate immune system . The bacterium also utilizes siderophore-independent mechanisms for iron acquisition during infection, alongside catecholate-type siderophores like chromobactin and viobactin . Exoproteomic studies have identified other virulence factors, including collagenase, flagellum proteins, metallopeptidases, and toxins .

Role of ChuP in Iron Acquisition

The chuPRSTUV operon in C. violaceum encodes a Fur-regulated heme uptake system (ChuRTUV) essential for heme and hemoglobin utilization . ChuP, a small heme-binding protein, is required for both heme and siderophore-mediated iron acquisition . It acts as a post-transcriptional activator of the TBDR genes chuR and vbuA, which are involved in heme/hemoglobin and siderophore viobactin uptake, respectively .

ChuP's Regulatory Function

Research indicates that ChuP functions as a heme-binding post-transcriptional regulator . In vitro experiments have demonstrated that recombinant His-ChuP protein binds heme, forming a complex with a specific binding affinity :

ParameterValue
Soret peak413 nm
Dissociation const.18.36 ± 4.66 µM

ChuP does not regulate the promoter of the chu operon directly but influences the expression of chuR and vbuA by interacting with HPRE elements located upstream of these genes .

Antibiotic-Induced Responses and Regulation

C. violaceum can respond to sublethal concentrations of antibiotics, particularly those inhibiting translation . This response includes the increased production of violacein, biofilm formation, and virulence against Drosophila melanogaster . The antibiotic-induced response is mediated by the Air (antibiotic-induced response) two-component regulatory system, which connects to quorum-dependent signaling and the negative regulator VioS . The Air system, comprising AirS and AirR, controls siderophore homeostasis . Additionally, the transcription factor VitR regulates siderophore, violacein, and biofilm formation in C. violaceum .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
CV_3485; UPF0060 membrane protein CV_3485
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-113
Protein Length
full length protein
Species
Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)
Target Names
CV_3485
Target Protein Sequence
MEWLTGLPRVAGLFVLTALAEIVGCYLPWLVLREGRSLWLLAPTTLALALFAWLLTLHPA AAGRTYAAYGGVYVTVAIAWLWLVDGVRPDRWDALGCALALAGMAVIMLAPRS
Uniprot No.

Target Background

Database Links

KEGG: cvi:CV_3485

STRING: 243365.CV_3485

Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Chromobacterium violaceum UPF0060 membrane protein CV_3485?

Chromobacterium violaceum UPF0060 membrane protein CV_3485 is a protein encoded by the CV_3485 gene found in Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757). The protein belongs to the UPF0060 protein family, which consists of membrane proteins with currently uncharacterized functions. As a membrane protein, it is likely involved in cellular processes that require integration within the cell membrane, potentially including transport, signaling, or structural functions .

Which expression systems are available for recombinant production of CV_3485?

Recombinant CV_3485 can be produced using multiple expression systems, each with distinct advantages depending on your research requirements:

Expression SystemProduct CodeSpecial FeaturesApplications
E. coliCSB-EP762934CKA1Standard expressionBasic functional studies
E. coli with Avi-tagCSB-EP762934CKA1-BBiotinylated in vivo via BirA technologyProtein-protein interaction studies, pull-down assays
YeastCSB-YP762934CKA1Eukaryotic expressionStudies requiring post-translational modifications
BaculovirusCSB-BP762934CKA1Insect cell expressionComplex eukaryotic modifications
Mammalian cellCSB-MP762934CKA1Highest-level eukaryotic expressionStudies requiring authentic mammalian modifications

The biotinylated version utilizes AviTag-BirA technology, where BirA catalyzes amide linkage between biotin and a specific lysine residue in the AviTag peptide .

What are the basic reconstitution methods for lyophilized CV_3485?

The reconstitution of lyophilized CV_3485 requires careful handling to maintain protein integrity. The general protocol includes:

  • Centrifuging the vial briefly before opening to ensure all material is at the bottom

  • Reconstituting the protein in deionized sterile water

  • Allowing complete dissolution by gentle mixing

  • Preparing aliquots to avoid repeated freeze-thaw cycles

  • Storage at -80°C for long-term use or at 4°C for short-term applications

Optimization of buffer conditions may be required depending on downstream applications, as membrane proteins often require specific detergent or lipid environments to maintain native conformation .

How does the partial nature of recombinant CV_3485 impact experimental design?

The commercially available recombinant CV_3485 is produced as a partial protein rather than the full-length sequence. This characteristic has several important implications for research design:

  • Domain-specific studies: The partial protein may contain specific functional domains while lacking others, making it suitable for domain-focused investigations but potentially limiting for whole-protein function studies

  • Structural analysis: Crystal or NMR structure determination projects must account for the partial nature of the protein, as the fragment may adopt conformations different from the full-length protein

  • Antibody generation: Antibodies raised against the partial protein may recognize only specific epitopes of the native protein

  • Interaction studies: Protein-protein interaction profiles may be incomplete if binding partners interact with regions absent in the partial construct

When designing experiments, researchers should determine which regions are present in the partial construct and assess whether these regions contain the domains of interest for their specific research questions .

What analytical techniques are most appropriate for characterizing CV_3485 membrane integration?

Characterizing membrane integration of CV_3485 requires specialized techniques that can provide information about protein-membrane interactions:

  • Detergent Screening Assays: Systematic testing of various detergents to identify optimal solubilization conditions

    • Critical micelle concentration (CMC) determination

    • Protein activity retention assessment in different detergents

  • Liposome Reconstitution:

    • Preparation of proteoliposomes with controlled lipid composition

    • Sucrose gradient centrifugation to confirm integration

  • Biophysical Characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure in membrane-mimetic environments

    • Fluorescence spectroscopy to monitor conformational changes

  • Topology Mapping:

    • Protease protection assays

    • Cysteine scanning mutagenesis coupled with accessibility studies

    • Fluorescence resonance energy transfer (FRET) analysis

These techniques can provide complementary information about how CV_3485 integrates into membranes, which is crucial for understanding its potential functional roles and for designing experiments to probe those functions.

How can structural homology modeling inform functional studies of CV_3485?

Given that CV_3485 belongs to the UPF0060 family of uncharacterized membrane proteins, homology modeling can provide valuable insights into its potential structure and function:

  • Template Identification:

    • Search for structural homologs using sequence-based (BLAST, HHpred) and structure-based (Phyre2, I-TASSER) tools

    • Evaluate template quality using sequence identity, coverage, and resolution metrics

  • Model Building and Validation:

    • Generate multiple models using different algorithms

    • Validate models using PROCHECK, VERIFY3D, and ProSA

    • Assess membrane-specific validation metrics using tools like QMEANBrane

  • Functional Site Prediction:

    • Identify conserved residues across UPF0060 family members

    • Map conserved residues onto the structural model

    • Use cavity detection algorithms to identify potential binding pockets

  • Experimental Validation Strategy:

    • Design site-directed mutagenesis experiments targeting predicted functional residues

    • Develop functional assays based on predicted activities

    • Use crosslinking studies to validate predicted protein-protein interaction interfaces

By integrating computational predictions with targeted experiments, researchers can develop hypotheses about CV_3485 function that might not be immediately apparent from sequence analysis alone.

What considerations should guide experimental design when using the biotinylated Avi-tag variant of CV_3485?

The biotinylated variant of CV_3485 (CSB-EP762934CKA1-B) offers unique advantages for certain experimental applications, but requires specific considerations:

  • Binding Kinetics and Affinity:

    • The biotin-streptavidin interaction has a Kd of approximately 10^-15 M, making it essentially irreversible under standard conditions

    • This property enables stringent washing conditions in pull-down experiments

  • Potential Interference with Protein Function:

    • The Avi-tag is positioned at a specific terminus (information on exact position would need to be confirmed with the supplier)

    • Researchers should assess whether tag placement might interfere with membrane integration or functional domains

  • Orientation Control in Surface Immobilization:

    • The site-specific biotinylation enables controlled orientation on streptavidin-coated surfaces

    • This property is valuable for single-molecule studies and biosensor development

  • Experimental Applications:

    • Surface plasmon resonance (SPR) for interaction studies

    • Pull-down assays with streptavidin-coated beads

    • Super-resolution microscopy using fluorophore-conjugated streptavidin

  • Controls and Validation:

    • Include non-biotinylated variants as controls

    • Verify biotinylation efficiency using mass spectrometry or Western blot

    • Test whether biotinylation affects membrane integration capability

The in vivo biotinylation process catalyzed by BirA ligase ensures high efficiency and specificity of biotin attachment to the AviTag peptide, reducing batch-to-batch variation compared to chemical biotinylation methods .

What strategies can overcome solubility challenges when working with CV_3485?

Membrane proteins like CV_3485 present inherent solubility challenges that require specialized approaches:

  • Detergent Optimization Matrix:

Detergent ClassExamplesAdvantagesPotential Limitations
Non-ionicDDM, Triton X-100Mild, preserve activityMay form large micelles
ZwitterionicCHAPS, LDAOGood for crystallizationCan be more denaturing
Steroid-basedDigitonin, GDNPreserve complexesExpensive, variable purity
Peptide-basedSMA copolymersExtract native lipid environmentpH limitations
  • Solubility Enhancement Approaches:

    • Fusion protein strategies (MBP, SUMO, or thioredoxin tags)

    • Co-expression with chaperones

    • Directed evolution for improved solubility

    • Truncation constructs to remove highly hydrophobic regions

  • Membrane Mimetics Beyond Detergents:

    • Nanodiscs: Protein reconstitution in disc-shaped lipid bilayers stabilized by scaffold proteins

    • Amphipols: Amphipathic polymers that wrap around the hydrophobic regions of membrane proteins

    • Bicelles: Disc-shaped lipid-detergent mixed micelles

    • Lipid cubic phases: Three-dimensional lipidic mesophases

  • Screening Protocol:

    • Small-scale expression tests with different constructs

    • Systematic detergent screening using fluorescence-detection size exclusion chromatography (FSEC)

    • Thermal stability assays in different solubilization conditions

Implementing a systematic approach to solubility optimization is crucial for obtaining sufficient quantities of properly folded CV_3485 for downstream structural and functional studies.

How can membrane protein reconstitution systems be optimized for functional studies of CV_3485?

Functional characterization of CV_3485 likely requires reconstitution into membrane-mimetic environments that preserve native structure and activity:

  • Proteoliposome Preparation Protocol:

    • Detergent solubilization of purified protein

    • Mixing with lipids at optimized protein:lipid ratios

    • Controlled detergent removal via:

      • Dialysis (gentle but time-consuming)

      • Bio-Beads addition (faster but potential protein adsorption)

      • Cyclodextrin complexation (rapid but concentration-sensitive)

    • Verification of reconstitution by freeze-fracture electron microscopy or density gradient centrifugation

  • Lipid Composition Optimization:

    • Systematic testing of different lipid compositions:

      • Native bacterial membrane lipids

      • Defined synthetic mixtures

      • Lipids with varying head groups and acyl chain lengths

  • Functional Validation Approaches:

    • Orientation determination using protease protection assays

    • Activity assays based on predicted function (transport, enzymatic, etc.)

    • Structural integrity assessment via circular dichroism or fluorescence spectroscopy

  • Advanced Reconstitution Platforms:

    • Droplet interface bilayers for electrical recordings

    • Supported lipid bilayers for surface-sensitive techniques

    • Microfluidic systems for high-throughput reconstitution optimization

The choice of reconstitution system should be guided by the specific functional assays planned for CV_3485, as different platforms offer distinct advantages for various analytical techniques.

What quality control methods should be employed to verify recombinant CV_3485 integrity?

Rigorous quality control is essential for membrane protein research to ensure that experimental results reflect true biological properties:

  • Purity Assessment:

    • SDS-PAGE analysis (reported >85% purity for commercial preparations)

    • Size exclusion chromatography

    • Mass spectrometry for accurate molecular weight determination

  • Structural Integrity Verification:

    • Circular dichroism to confirm secondary structure content

    • Tryptophan fluorescence to assess tertiary structure

    • Thermal shift assays to evaluate stability

  • Functional Verification:

    • Binding assays if ligands are known

    • Activity assays if enzymatic function is established

    • Interaction studies with known partners

  • Batch Consistency Monitoring:

    • Standardized analytical protocols across preparations

    • Reference standards for comparative analysis

    • Documentation of storage conditions and freeze-thaw cycles

Implementing comprehensive quality control workflows ensures that experimental outcomes can be confidently attributed to biological properties rather than sample preparation artifacts .

How should researchers approach experimental design when functional annotation of CV_3485 is limited?

When working with proteins of unknown function like CV_3485, systematic exploratory approaches are essential:

  • Computational Function Prediction Pipeline:

    • Sequence-based methods: BLAST, PSI-BLAST against characterized proteins

    • Structure-based prediction: Threading, homology modeling, binding site prediction

    • Genomic context analysis: Operon structure, gene neighborhood conservation

    • Evolutionary analysis: Identification of conserved residues that may indicate functional sites

  • Screening Strategy for Experimental Function Discovery:

    • Ligand binding arrays with diverse chemical libraries

    • Interaction partner identification via pull-down coupled with mass spectrometry

    • Phenotypic analysis of knockout/knockdown in native organism

    • Heterologous expression impact on host cell physiology

  • Systematic Characterization Workflow:

    • Start with broad assays (membrane potential, transport)

    • Progress to more specific hypotheses based on initial results

    • Combine complementary techniques to build evidence for function

    • Use appropriate positive and negative controls for all assays

  • Collaborative Approaches:

    • Multi-disciplinary teams combining structural biology, biochemistry, and microbiology expertise

    • Data sharing through specialized membrane protein databases

    • Integration with broader Chromobacterium violaceum research community

By implementing systematic approaches to function discovery, researchers can develop and test hypotheses about CV_3485's biological role despite limited initial functional annotation.

What are the emerging techniques that could advance understanding of CV_3485 function?

Several cutting-edge methodologies show promise for elucidating the function of challenging membrane proteins like CV_3485:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Single-particle analysis for high-resolution structure determination

    • Visualization of membrane proteins in native-like lipid environments

    • Potential to capture multiple conformational states

  • Integrative Structural Biology:

    • Combining multiple experimental data sources (X-ray, NMR, SAXS, crosslinking)

    • Computational integration for comprehensive structural models

    • Capturing dynamic aspects of membrane protein function

  • Advanced Mass Spectrometry:

    • Native MS for intact membrane protein complexes

    • Hydrogen-deuterium exchange for conformational dynamics

    • Crosslinking MS for interaction interface mapping

  • Artificial Intelligence Approaches:

    • AlphaFold and similar tools for improved structure prediction

    • Machine learning for functional annotation based on structural features

    • Network analysis tools for contextualizing protein function within cellular pathways

  • Single-Molecule Techniques:

    • FRET studies to monitor conformational changes

    • Optical tweezers for mechanical property analysis

    • High-speed AFM for dynamic structural visualization

These emerging techniques can provide complementary insights into CV_3485 structure and function, potentially revealing its biological role in Chromobacterium violaceum.

How can researchers studying CV_3485 contribute to broader understanding of UPF0060 family proteins?

Research on CV_3485 can advance knowledge of the entire UPF0060 protein family through strategic approaches:

  • Comparative Studies Framework:

    • Parallel characterization of multiple UPF0060 family members

    • Identification of conserved structural and functional features

    • Development of family-wide functional hypotheses

  • Repository Development:

    • Standardized protocols for expression and purification

    • Centralized database for experimental results

    • Resource sharing through public repositories

  • Targeted Investigation Areas:

    • Membrane topology determination across the family

    • Conservation analysis of predicted functional sites

    • Cross-species complementation studies

  • Collaborative Research Network:

    • Multi-laboratory initiatives focusing on different family members

    • Regular data-sharing workshops or conferences

    • Coordinated publication strategies to build comprehensive literature

By situating CV_3485 research within the broader context of UPF0060 family proteins, individual studies can contribute to systematic functional annotation of this uncharacterized protein family.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.