Recombinant Chromohalobacter salexigens ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

ATP Synthase Subunit a: Functional Overview

ATP synthase is a key enzyme in energy metabolism, catalyzing ATP synthesis via proton translocation across membranes. Subunit a is a hydrophobic component critical for proton channel formation and energy coupling. Its recombinant production typically involves cloning the atpB gene into bacterial expression systems (e.g., E. coli) and purification via affinity tags like His-tag.

Chromohalobacter salexigens: Relevance in Extremophile Research

C. salexigens is renowned for its osmoregulation mechanisms, particularly ectoine and hydroxyectoine synthesis, which enable survival in high-salinity environments . Despite extensive studies on its metabolic adaptations, no peer-reviewed publications explicitly describe recombinant atpB from this organism.

Recombinant ATP Synthase Subunit a: Cross-Species Data

Recombinant atpB proteins from other bacteria are commercially available, including:

Protein IDOrganismLength (aa)TagVendor
Q5XCY5Halomonas salina1–238N-terminal HisCreative Biomart
Q7CND5Pseudomonas fluorescens1–238N-terminal HisCreative Biomart
Q8XGC2Mycobacterium tuberculosis1–271N-terminal HisCreative Biomart

Note: These entries represent atpB from non-C. salexigens species. No similar products for C. salexigens were identified in the provided sources.

Lack of Direct Studies

Current literature focuses on C. salexigens’ compatible solute biosynthesis (e.g., ectoine, hydroxyectoine) and metabolic adaptations , but not ATP synthase components.

Cloning and Expression Challenges

Recombinant protein production in halophiles often requires specialized conditions (e.g., high-salt buffers). For example:

  • Gene Cloning: Restriction enzyme-based methods (e.g., NdeI/EcoRI) have been used for other C. salexigens proteins, such as Rubisco-like proteins .

  • Expression Optimization: Lower temperatures (e.g., 16°C) improve solubility in E. coli .

Potential Applications and Future Directions

While not yet explored for C. salexigens, recombinant ATP synthase subunits from extremophiles could:

  1. Study Energy Metabolism: Elucidate proton translocation mechanisms in halophilic environments.

  2. Biotechnological Tools: Develop thermostable or salt-resistant enzymes for industrial processes.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order. We will fulfill your specific needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; Csal_3290; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768)
Target Names
atpB
Target Protein Sequence
MAGNNPTSSEYIQHHLQNMTFGLHPENGLGLAHSAQEAQEMGFWAIHLDTMGWSIGLGVL FLWLFRSVAKSVSTGVPGGLQNFVEMMVEFVDNSVRETFHGKSKLIAPLSLTIFCWIFLM NLMDLVPVDFLPMLAQKIGAWFGADPAHVYFKVVPTTDVNATLGMSLAVFALIIFYSIRS KGLSGFLAELTLHPFNASNPFVQALLIPVNFLLEAVTLLAKPVSLALRLFGNLYAGELIF ILIAMIGLWQLPLHFAWATFHILIITLQAFIFMMLTIVYLSMATEKH
Uniprot No.

Target Background

Function
ATP synthase subunit a (atpB) is a key component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of ATP synthase subunit a (atpB) in the bioenergetics of Chromohalobacter salexigens?

ATP synthase subunit a (atpB) forms part of the F₀ membrane sector of the ATP synthase complex and plays a critical role in proton translocation across the cell membrane. In C. salexigens, the atpB subunit likely contributes to the establishment of the proton motive force that drives ATP synthesis under salt stress conditions. Similar to other bacterial ATP synthases, subunit a in C. salexigens works in conjunction with the c-ring rotor to convert the energy of the transmembrane proton gradient into mechanical rotation, ultimately leading to ATP synthesis in the F₁ catalytic sector . The unique structure of this subunit contains hydrophobic transmembrane helices that form a channel for proton translocation. The a-subunit coordinates with other membrane subunits to maintain the structural integrity of the ATP synthase complex while contributing to its functional capacity under high salt conditions. Current structural models suggest that specific residues in subunit a form a critical part of the proton translocation pathway, making it essential for energy conservation in this halophilic organism.

What are the recommended methods for cloning and expressing recombinant C. salexigens atpB?

For successful cloning and expression of recombinant C. salexigens atpB, researchers should consider using an E. coli expression system with modifications to accommodate the halophilic nature of the target protein. The gene sequence should be codon-optimized for E. coli expression and placed under the control of an inducible promoter such as T7 or arabinose-inducible systems. Based on protocols used for similar bacterial ATP synthases, the inclusion of a C-terminal or N-terminal His-tag facilitates subsequent purification while minimizing interference with protein function . When designing expression constructs, researchers should avoid disrupting critical functional domains in the atpB sequence. Expression conditions should be optimized by testing various induction temperatures (20-37°C), inducer concentrations, and induction durations to maximize protein yield while maintaining proper folding. Since membrane proteins often present expression challenges, specialized E. coli strains such as C41(DE3) or C43(DE3) designed for membrane protein expression may yield better results. Additionally, incorporating molecular chaperones like GroEL/GroES in the expression system can enhance proper folding of this complex transmembrane protein.

How does the structure of C. salexigens ATP synthase compare to ATP synthases from non-halophilic bacteria?

C. salexigens ATP synthase likely possesses structural adaptations that enable functionality in high-salt environments compared to non-halophilic counterparts. While specific structural data for C. salexigens ATP synthase is not yet fully characterized, comparative analysis with other bacterial ATP synthases such as those from Bacillus PS3 provides valuable insights . The a-subunit (atpB) in halophilic organisms typically contains an increased proportion of acidic amino acids on its surface and reduced hydrophobic residues in its core regions, enabling better solvation and stability in high-salt environments. Structural models based on cryo-EM studies of bacterial ATP synthases show that subunit a contains multiple transmembrane helices that form critical interactions with the c-ring rotor, creating the pathway for proton translocation across the membrane . In C. salexigens, this structure likely incorporates salt-adaptive modifications while maintaining the core functional architecture required for energy conservation. Unlike the mitochondrial ATP synthase, which requires additional subunits in the F₀ region, the bacterial ATP synthase, including that from C. salexigens, achieves the same function with a simpler subunit composition, wherein structural loops in subunit a fulfill roles played by additional subunits in more complex systems .

What mechanisms might C. salexigens employ to maintain ATP synthase function under extreme salt stress?

C. salexigens employs multiple adaptive mechanisms to maintain ATP synthase functionality under extreme salt conditions. Transcriptome analysis reveals that C. salexigens upregulates genes for compatible solutes like glycine betaine (gbcA, gbcB) and transporters (OpuAC, OpuAA, OpuAB) when salt concentration increases . These osmoprotectants likely help stabilize ATP synthase structure and function under high ionic strength. The ATP synthase complex may undergo conformational changes to accommodate altered membrane fluidity under salt stress, with the atpB subunit playing a critical role in maintaining proton/sodium conductance pathways. C. salexigens might employ ion specificity adaptations similar to those observed in other extremophiles; for instance, some bacterial ATP synthases can utilize sodium ions instead of protons for ATP synthesis under certain conditions, as demonstrated in Enterococcus hirae . The structural integrity of the a-subunit is likely maintained through salt-adaptive features such as increased negative surface charge, reduced hydrophobic core, and strategic placement of salt bridges. Additionally, specific post-translational modifications or interactions with salt-induced chaperones may contribute to ATP synthase stability under extreme conditions.

What specific amino acid residues in C. salexigens atpB are critical for proton translocation under varying salt concentrations?

Based on structural studies of bacterial ATP synthases, several conserved residues in subunit a are likely critical for proton translocation in C. salexigens. Though specific residues in C. salexigens atpB have not been fully characterized, homology modeling based on bacterial ATP synthases suggests that conserved arginine residues (equivalent to Arg210 in E. coli) likely play essential roles in proton translocation . This positively charged residue creates an electrostatic environment crucial for proton movement between subunit a and the c-ring. Additionally, conserved glutamate or aspartate residues in transmembrane helices would contribute to the proton pathway, with their positioning precisely calibrated to optimize proton transfer under high salt conditions. Site-directed mutagenesis studies targeting these residues would be valuable for understanding their specific contributions. Halophilic adaptations might include additional acidic residues on the surface of atpB that interact with hydrated salt ions, maintaining structural stability without compromising function. Potential salt-bridging networks unique to halophilic ATP synthases could provide structural resilience while maintaining the dynamic movements necessary for ATP synthesis. Researchers investigating these critical residues should employ a combination of sequence alignment, homology modeling, and targeted mutagenesis approaches to identify the precise molecular mechanisms of salt adaptation.

What purification protocols are most effective for isolating functional recombinant C. salexigens atpB?

For effective purification of recombinant C. salexigens atpB, researchers should adapt protocols from successful bacterial ATP synthase purifications with modifications to accommodate halophilic properties. Based on established methods for bacterial ATP synthases, a recommended protocol begins with bacterial cell lysis under conditions that maintain protein stability (typically including 20 mM Tris-HCl pH 7.4, 5 mM MgCl₂, and appropriate NaCl concentration) . For C. salexigens atpB, maintaining 0.5-2.0 M NaCl throughout purification may be necessary to preserve native folding. Membrane fraction isolation through differential centrifugation should be followed by solubilization using mild detergents like glycol-diosgenin (GDN) at 0.5-1% (w/v), which has proven effective for bacterial ATP synthase components . Affinity chromatography using Ni-NTA resin for His-tagged atpB provides initial purification, with washing buffers containing 20-40 mM imidazole and elution with 200-300 mM imidazole. Size exclusion chromatography using a Superose 6 column equilibrated with buffer containing the appropriate salt concentration and 0.02% detergent provides final purification . Throughout the process, addition of stabilizing agents such as glycerol (10% w/v), sucrose (250 mM), and protease inhibitors (5 mM 6-aminocaproic acid, 5 mM benzamidine, 1 mM PMSF) helps maintain protein integrity . All buffers should be supplemented with sufficient salt to maintain the stability of this halophilic protein.

How can researchers assess the functional activity of purified recombinant C. salexigens atpB?

Assessment of purified recombinant C. salexigens atpB functionality requires both direct and indirect approaches to verify its contribution to ATP synthase activity. Researchers should first incorporate the purified atpB into proteoliposomes through established reconstitution protocols, similar to those used for other bacterial ATP synthases . Functional assessment can then proceed through ATP synthesis assays where artificial ion gradients (sodium or proton) are established across the liposomal membrane. Using valinomycin to generate a potassium diffusion potential (Δψ) of approximately 160 mV in combination with an ion gradient (ΔpNa or ΔpH) can create sufficient driving force for ATP synthesis . ATP production can be measured using a luciferase-based bioluminescence assay, which allows continuous monitoring of ATP synthesis rates . Control experiments should include conditions with collapsed ion gradients (using ionophores like ETH2120 for Na⁺ or TCS for H⁺) to confirm gradient-dependent ATP synthesis . Additionally, researchers should test specific inhibitors such as DCCD, which binds to the c-ring but can be competed off by sodium ions in Na⁺-dependent ATP synthases, to verify the ion-coupling mechanism . Structural integrity of the reconstituted complex can be assessed through negative-stain electron microscopy or, ideally, cryo-EM to visualize the incorporation of atpB into the complete ATP synthase complex.

What mutagenesis approaches can be used to study structure-function relationships in C. salexigens atpB?

To investigate structure-function relationships in C. salexigens atpB, researchers should employ a multi-faceted mutagenesis strategy targeting conserved and halophile-specific residues. Site-directed mutagenesis should focus on conserved charged residues (arginine, glutamate, aspartate) likely involved in proton/sodium translocation pathways based on homology with well-characterized bacterial ATP synthases . Alanine-scanning mutagenesis of transmembrane helices can systematically identify residues critical for proton conduction or structural stability. Conservative substitutions (e.g., Asp to Glu) can help distinguish between residues involved in proton coordination versus structural roles. Domain-swapping experiments, wherein corresponding regions from non-halophilic bacterial atpB are substituted into C. salexigens atpB, can identify salt-adaptation domains. For each mutant, researchers should assess expression levels, membrane integration, ATP synthesis activity, and salt tolerance using the functional assays described previously. Thermostability assays comparing wild-type and mutant proteins across various salt concentrations can reveal the contribution of specific residues to salt adaptation. Cysteine-scanning mutagenesis combined with accessibility studies using thiol-reactive probes can map the solvent-exposed surfaces of transmembrane segments. Advanced approaches may include incorporation of non-natural amino acids at specific positions to introduce photo-crosslinking or fluorescent probes for dynamic studies of atpB under varying salt conditions.

How might structural studies of C. salexigens atpB contribute to our understanding of ATP synthase evolution in extremophiles?

Structural characterization of C. salexigens atpB would provide critical insights into evolutionary adaptations of ATP synthases to extreme environments. High-resolution structures obtained through cryo-EM or X-ray crystallography would allow comparison with ATP synthases from mesophilic bacteria, archaea, and eukaryotes, revealing convergent or divergent evolutionary strategies for functioning in high-salt environments . Such comparisons could illuminate how halophilic ATP synthases maintain functional ion pathways while adapting surface properties to high ionic strength. Particular attention should focus on the architectural differences in the proton channel formed by subunit a and its interface with the c-ring, which might reveal specialized adaptations for maintaining proton motive force under osmotic stress. Structural studies might also reveal previously unidentified interaction partners specific to halophilic organisms that contribute to complex stability. Examining the evolution of ion specificity (H⁺ vs. Na⁺) in relation to environmental adaptation could provide insights into the ancient divergence of ATP synthase lineages . The existence of V-type rotor elements in some bacterial and archaeal ATP synthases suggests complex evolutionary histories that structural data from diverse extremophiles like C. salexigens could help clarify . Additionally, characterizing potential structural adaptations that allow ATP synthesis at reduced driving forces would be particularly valuable, as extremophiles often exist near thermodynamic limits, requiring efficient energy conservation mechanisms.

What potential applications exist for recombinant C. salexigens atpB in biotechnology and synthetic biology?

Recombinant C. salexigens atpB holds significant potential for various biotechnological applications due to its adaptation to extreme salt conditions. Engineering salt-tolerant bioenergetic systems for bioremediation of hypersaline environments could utilize C. salexigens atpB to create robust energy-generating modules that function under conditions prohibitive to conventional systems. The halophilic properties of this protein could be harnessed to develop novel bioelectronic devices that operate in high-salt environments, including biosensors for marine monitoring or brine analysis. Structure-guided protein engineering could adapt C. salexigens atpB for incorporation into artificial cell systems designed to function in non-conventional media, expanding the environmental range of synthetic cells. The unique ion translocation properties of halophilic ATP synthases might be exploited to develop specialized energy conversion systems for biohydrogen production or other bioenergy applications under extreme conditions. Fundamental insights from C. salexigens atpB structure-function relationships could inform the design of novel nanomotors or molecular machines capable of operating in high ionic strength environments. Additionally, understanding the molecular basis of salt adaptation in this essential enzyme could contribute to strategies for engineering salt tolerance in crops, potentially addressing agricultural challenges posed by increasing soil salinity . Each of these applications would benefit from detailed structural and functional characterization of the recombinant protein under varying conditions.

How can comparative analysis of C. salexigens atpB with other extremophile ATP synthases advance bioenergetic research?

Comparative analysis of C. salexigens atpB with ATP synthases from other extremophiles would provide valuable insights into diverse bioenergetic adaptation strategies. Researchers should systematically compare sequence features, structural elements, and functional properties of ATP synthases from halophiles, thermophiles, acidophiles, and alkaliphiles to identify common principles versus environment-specific adaptations in energy conservation mechanisms. Such comparisons could reveal whether different extreme environments drive convergent or divergent solutions to bioenergetic challenges. Of particular interest would be comparing ion specificity and the minimal driving forces required for ATP synthesis across different extremophiles . For instance, some extremophile ATP synthases can function with driving forces as low as 90 mV, approaching theoretical thermodynamic limits . Comparative structural studies focusing on the a-subunit and its interface with the c-ring could elucidate how diverse extremophiles maintain critical ion pathways while adapting to environmental stresses. Researchers should develop standardized functional assays that allow direct comparison of ATP synthesis efficiency under controlled conditions mimicking various extreme environments. Additionally, analyzing horizontal gene transfer patterns of ATP synthase components across extremophile lineages could provide evolutionary context for these adaptations. The integration of structural, functional, and evolutionary data from diverse extremophiles including C. salexigens would significantly advance our understanding of the fundamental principles governing biological energy conversion under challenging conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.