Recombinant Chromohalobacter salexigens Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Chromohalobacter salexigens Glycerol-3-phosphate acyltransferase (PlsY) is a bacterial enzyme critical for lipid biosynthesis. This protein catalyzes the transfer of acyl groups from acyl-phosphate to glycerol-3-phosphate (G3P), forming lysophosphatidic acid (LPA)—a key precursor for phospholipid synthesis . Produced recombinantly in E. coli with a His-tag, PlsY serves as a vital tool for studying membrane biogenesis and osmoregulation in halophilic bacteria . Below, we synthesize structural, functional, and application-focused data from diverse sources to provide a comprehensive overview of this enzyme.

Role in Osmoadaptation

C. salexigens thrives in high-salinity environments (up to 25% NaCl) by modulating membrane composition and accumulating compatible solutes like ectoine . While PlsY itself is not directly involved in ectoine synthesis, its activity ensures membrane fluidity and ion homeostasis under osmotic stress . Transcriptomic studies reveal that salinity upregulates genes linked to lipid metabolism, indirectly supporting PlsY’s role in maintaining membrane integrity .

Metabolic Network Integration

Genome-scale metabolic modeling of C. salexigens highlights PlsY’s contribution to phospholipid biosynthesis, which is tightly coupled to central carbon metabolism . Under high salinity, the organism prioritizes glycerol-3-phosphate utilization for lipid synthesis over glycolysis, minimizing metabolic overflow (e.g., acetate excretion) .

Research Tool

  • Lipid Metabolism Studies: Used to investigate bacterial membrane adaptation mechanisms under osmotic stress .

  • Enzyme Engineering: Serves as a template for optimizing acyltransferase activity in synthetic biology applications .

Industrial Relevance

  • Biotechnological Production: Potential use in engineered pathways for phospholipid or bio-surfactant synthesis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference in the order notes. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All protein shipments include standard blue ice packs. For dry ice shipment, please contact us in advance for an additional fee.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) and aliquoting is recommended for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage state, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; Csal_0972; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768)
Target Names
plsY
Target Protein Sequence
MSSPLPMTALVLAGYLSGSLLGAVWVCRALGRRDPRHAGSRNPGFSNVLRLHGVVPAALT LGVDAAKAMPVLWVAQREALPIWAQGAVGLSVLVGHSYPLWHRGRGGKAVASAFGVLLMI ATPVAWVCALCWALLAWRSRTAAVASLAAALLAPLASYWLAREATLVVSVFSALVLVRHA WNIRRLGQGGEPGLKREERIKPPEE
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as a fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Chromohalobacter salexigens and why is it significant in research?

Chromohalobacter salexigens is a halophilic bacterium that has gained significant attention in research due to its exceptional ability to adapt to both osmotic and heat stress. This organism synthesizes and accumulates compatible solutes, primarily ectoine and hydroxyectoine, in response to environmental stressors . C. salexigens has potential biotechnological applications as an alternative cell factory for the production of these compatible solutes, which have therapeutic potential for diseases caused by protein misfolding . The bacterium is strictly aerobic, cytochrome c oxidase-negative, and possesses a branched respiratory chain, making it an interesting model organism for studying adaptation mechanisms to extreme environments .

What is Glycerol-3-phosphate acyltransferase (plsY) and what is its function in C. salexigens?

Glycerol-3-phosphate acyltransferase (plsY) in C. salexigens is an enzyme involved in phospholipid biosynthesis. It catalyzes the acylation of glycerol-3-phosphate to form lysophosphatidic acid (LPA), which is a crucial intermediate in the synthesis of membrane phospholipids . This enzyme is also known by several synonyms including Acyl-PO4 G3P acyltransferase, G3P acyltransferase (GPAT), and LPA synthase . In C. salexigens, which thrives in high-salt environments, membrane lipid composition plays a vital role in maintaining cellular integrity under osmotic stress conditions. The plsY gene is identified as Csal_0972 in the C. salexigens genome .

How might plsY function relate to C. salexigens' adaptation to osmotic and heat stress?

While direct evidence connecting plsY to stress response mechanisms in C. salexigens is limited in the available research, we can infer potential relationships based on cellular physiology. As a membrane lipid biosynthesis enzyme, plsY likely plays an indirect but critical role in stress adaptation through maintenance of membrane integrity.

The RNA-seq analysis revealed that salinity and temperature induced shifts in the respiratory chain and associated components . Membrane phospholipids synthesized through the pathway involving plsY would provide the structural environment for these respiratory complexes. Therefore, alterations in phospholipid composition mediated by plsY activity could be an essential part of the adaptation mechanism to maintain proper function of membrane-associated proteins under stress conditions.

What is the relationship between phospholipid metabolism and compatible solute production in C. salexigens?

The relationship between phospholipid metabolism (involving plsY) and compatible solute production in C. salexigens involves several interconnected cellular processes. Research has shown that C. salexigens accumulates compatible solutes such as ectoine and hydroxyectoine in response to salt and temperature stress . These solutes function as osmolytes and also protect macromolecules, including membrane components, from denaturation.

The production and accumulation of these compatible solutes are influenced by Na+ and H+ gradients across the cell membrane . These ion gradients are maintained by the respiratory chain components and various transporters embedded in the phospholipid bilayer synthesized through pathways involving plsY. Experiments with specific ionophores have demonstrated that both Na+ and H+ gradients influence ectoine production, though with differences depending on salinity and temperature conditions .

The integrity and fluidity of the membrane, determined by its phospholipid composition, would affect the function of these transporters and consequently the ion gradients necessary for compatible solute production. Thus, plsY-mediated phospholipid biosynthesis may indirectly regulate compatible solute accumulation by maintaining proper membrane properties for the function of transport proteins and respiratory chain components.

How does iron homeostasis impact plsY function and phospholipid metabolism in C. salexigens?

Iron homeostasis has been shown to significantly impact compatible solute production in C. salexigens, which may indirectly relate to phospholipid metabolism and plsY function. Research has demonstrated that transcriptional induction of genes related to siderophore synthesis and transport correlates with higher siderophore production and intracellular iron content at low salinity .

More importantly, excess iron increases hydroxyectoine accumulation by approximately 20% at high salinity but reduces the intracellular content of ectoines by about 50% under combined high salinity and high temperature conditions . This suggests a complex relationship between iron homeostasis and osmoadaptation mechanisms.

For plsY and phospholipid metabolism, the connection may involve several factors:

  • Iron is a cofactor for many enzymes involved in metabolic processes, including those that generate precursors for phospholipid biosynthesis

  • Changes in membrane composition might be required to adapt to varying iron availability

  • Iron homeostasis affects oxidative stress levels, which in turn may impact membrane integrity and require adaptations in phospholipid composition

Given that plsY belongs to the Glycerol-3-phosphate acyltransferase family, its activity might be indirectly regulated by iron availability through metabolic shifts or changes in gene expression patterns associated with stress responses.

What are the optimal conditions for expression and purification of recombinant C. salexigens plsY?

Based on established protocols for recombinant C. salexigens plsY expression, the following methodological approach is recommended:

Expression System:

  • Host: Escherichia coli is the preferred expression system for recombinant plsY

  • Vector: Expression vectors containing an N-terminal His-tag fusion are recommended for easier purification

  • Induction: IPTG-inducible promoters are typically used, with optimal induction conditions determined empirically

Purification Protocol:

  • Cell Lysis: Standard methods using sonication or mechanical disruption in appropriate buffer systems

  • Purification: Ni-NTA affinity chromatography leveraging the His-tag

  • Quality Control: SDS-PAGE analysis to confirm purity (>90% purity is achievable)

  • Storage: Store in Tris/PBS-based buffer containing 6% trehalose at pH 8.0

Storage Recommendations:

  • Short-term (working aliquots): 4°C for up to one week

  • Long-term: -20°C/-80°C with 5-50% glycerol (final concentration)

  • Avoid repeated freeze-thaw cycles

  • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

What analytical methods are most effective for studying plsY enzyme activity in the context of stress response?

For investigating plsY enzyme activity in the context of C. salexigens stress response, several complementary analytical approaches are recommended:

Enzyme Activity Assays:

  • Spectrophotometric assays measuring the rate of acyl-CoA utilization or lysophosphatidic acid formation

  • Radioisotope-based assays using 14C or 3H-labeled glycerol-3-phosphate to track product formation

  • Coupled enzyme assays that link plsY activity to measurable changes in cofactor levels

Membrane Lipid Analysis:

  • Thin-layer chromatography (TLC) to separate and quantify different phospholipid species

  • Liquid chromatography-mass spectrometry (LC-MS) for detailed phospholipid profiling

  • Gas chromatography (GC) analysis of fatty acid methyl esters to determine acyl chain composition

Integration with Stress Response Studies:

  • RNA-seq analysis to correlate plsY expression with other stress-responsive genes, similar to the approach used for studying osmotic and thermal adaptation in C. salexigens

  • Quantitative proteomics to measure changes in plsY protein levels under different stress conditions

  • Metabolomics approaches to track changes in phospholipid intermediates and compatible solutes simultaneously

In vivo Studies:

  • Generate plsY knockout or conditional mutants to assess its role in stress tolerance

  • Complement with wild-type or modified plsY variants to confirm phenotypes

  • Label phospholipids in vivo with stable isotopes to track turnover rates under stress conditions

How can researchers overcome challenges in studying membrane-associated enzymes like plsY in halophilic bacteria?

Studying membrane-associated enzymes like plsY in halophilic bacteria presents unique challenges due to their hydrophobic nature and the high-salt environment required for proper folding. The following methodological approaches can help overcome these challenges:

Protein Solubilization and Stability:

  • Use appropriate detergents (e.g., n-dodecyl β-D-maltoside, Triton X-100) to solubilize membrane proteins while maintaining native structure

  • Include osmolytes like ectoine or hydroxyectoine in buffers to mimic the natural cytoplasmic environment of C. salexigens

  • Maintain physiologically relevant salt concentrations to preserve protein stability and activity

Expression Systems:

  • Consider cell-free expression systems that can be optimized for high-salt conditions

  • Explore halophilic expression hosts that might better maintain the native folding environment

  • Use fusion partners that enhance solubility while maintaining enzyme function

Structural Studies:

  • Employ nanodiscs or liposomes to reconstitute plsY in a membrane-like environment for structural studies

  • Consider cryo-electron microscopy for structural analysis, which may be more suitable than crystallography for membrane proteins

  • Use computational modeling based on homologous proteins to predict structure-function relationships

Functional Assays:

  • Develop assays that can function under high-salt conditions, accounting for potential interference

  • Use reconstituted proteoliposomes to measure enzyme activity in a context that mimics the native membrane environment

  • Implement microfluidic approaches to rapidly assess enzyme function under varying salt and temperature conditions

How might understanding plsY function contribute to biotechnological applications of C. salexigens?

Understanding plsY function in C. salexigens could significantly advance biotechnological applications in several areas:

Enhanced Ectoine Production:
C. salexigens has been identified as a potential alternative cell factory for the production of ectoines, which have applications as protecting agents for macromolecules, cells, tissues, and potential therapeutic use for protein misfolding diseases . By understanding how plsY-mediated phospholipid biosynthesis influences membrane properties and, consequently, compatible solute production, researchers could engineer strains with optimized membrane composition to enhance ectoine and hydroxyectoine yields.

Stress-Resistant Biosynthesis Systems:
Insights into how plsY contributes to membrane adaptation under stress conditions could enable the development of more robust industrial strains capable of functioning under harsh conditions. This knowledge could be applied to create bioreactors operating in high-salt environments or fluctuating temperatures while maintaining productivity.

Engineered Lipid Production:
Understanding the substrate specificity and regulation of plsY could allow for the engineering of C. salexigens strains producing modified phospholipids with novel properties. These could have applications in biofuel production, pharmaceutical delivery systems, or as industrial surfactants.

Bioremediation Applications:
C. salexigens' ability to thrive in high-salt environments makes it a candidate for bioremediation of contaminated saline environments. Optimizing plsY function could enhance the organism's tolerance to additional stressors encountered in contaminated sites, such as heavy metals or organic pollutants.

What are the current gaps in our understanding of plsY function in the context of C. salexigens biology?

Despite the available information on C. salexigens adaptation mechanisms and plsY characteristics, several significant knowledge gaps remain:

Regulatory Mechanisms:
How plsY expression and activity are regulated in response to changing environmental conditions remains largely unexplored. While RNA-seq analyses have provided insights into global transcriptional responses to osmotic and heat stress , specific information about plsY regulation is limited.

Protein-Protein Interactions:
The interaction partners of plsY in C. salexigens membrane lipid biosynthesis pathways have not been fully characterized. Understanding these interactions would provide insights into how plsY function is integrated with other cellular processes.

Post-Translational Modifications:
Information about potential post-translational modifications of plsY that might modulate its activity under different stress conditions is currently lacking.

Substrate Specificity:
Detailed characterization of plsY substrate preferences in C. salexigens, particularly how these might differ from homologous enzymes in non-halophilic bacteria, would enhance our understanding of membrane adaptation mechanisms.

Connection to Compatible Solute Metabolism:
While research has established connections between membrane properties and compatible solute production , the specific role of plsY-mediated phospholipid biosynthesis in these processes requires further investigation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.