Recombinant Chromohalobacter salexigens Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
msbA; Csal_1586; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-579
Protein Length
full length protein
Species
Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768)
Target Names
msbA
Target Protein Sequence
MRNATSWSLYRRLLSYVRPYWKAFLAAVVGYAIYAASSTALAEMMKRLIDGIQNPDAAFR LMLPLFVIGMFAARGVGTFLGTYYMSDVARNVVHALRCEVFNHMLRLPGRFFDMHSSGHL LSRVTYHVEQVTGAATNAITIILREGLFVIGLVSYLLWTNWMLTLIFMAVTPLIGLVVNY TSKRFRRLSRRIQNSMGDVTHVASEALSGYRVVRTHGAEAYEKARFAEASDYNREQSMKV ALTKAVSTPVIQLLVALSLAGLVWLAMSPALMASMTPGEFVAFITAASLMAKPVRQLTEV NSTIQKGLSASQELFGLLEQPPEVDEGSYVPARIDGRVRFEGVRFRYGEDQAEVLKGIDL DVPQGEMIAIVGRSGSGKSTLVSLMPRFYRPTEGRVLLDDVDIQEYALSPLRQRIALVSQ QVTLFNTTIAANIAYGHPDADREAVESAARSAYAHEFIERLPNGYDTVVGDNGVMLSGGQ RQRLAIARAIFKDAPLLVLDEATSALDTESERYIQQALERVCRGRTTFVIAHRLSTIERA DRILVMEQGEIIESGTHGELLAQDGAYAALHQLQFQEAE
Uniprot No.

Target Background

Function

MsbA is involved in lipopolysaccharide (LPS) biosynthesis. Its function includes translocating the lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMDs) form a pore within the inner membrane, while the ATP-binding domain (NBD) provides the necessary energy for this process.

Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.