Recombinant Chromohalobacter salexigens Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Description

Introduction

Peptidoglycan transglycosylases (PGTs) are essential enzymes involved in bacterial cell wall biosynthesis . These enzymes catalyze the polymerization of glycan strands, a crucial step in forming the peptidoglycan layer that provides structural integrity to the bacterial cell . Chromohalobacter salexigens is a halophilic bacterium known for its ability to thrive in high-salt environments and its production of compatible solutes like ectoine and hydroxyectoine . The genome of C. salexigens encodes various enzymes involved in peptidoglycan biosynthesis, including a monofunctional peptidoglycan transglycosylase designated as MtgA .

Characteristics of Chromohalobacter salexigens

Chromohalobacter salexigens is a moderately halophilic bacterium with a wide salinity growth range . This extremophilic microorganism has been extensively used to study the bacterial osmoadaptation process . C. salexigens has also been proposed as an alternative natural producer of ectoine and hydroxyectoine . Accumulation of hydroxyectoine is upregulated by salinity and temperature and is maximal at 45°C and 2.5 M NaCl, while accumulation of ectoine is upregulated by salinity and downregulated by temperature, reaching its maximum at 37°C and 2.5 M NaCl .

Role of Peptidoglycan in Bacteria

Peptidoglycan (PG) is a crucial component of the bacterial cell wall, essential for maintaining cell shape, resisting internal turgor pressure, and providing a scaffold for other cell wall components . PG consists of glycan strands cross-linked by short peptides, forming a mesh-like structure that surrounds the cell . The synthesis of peptidoglycan involves multiple enzymes, including peptidoglycan transglycosylases (PGTs), which polymerize the glycan strands .

MtgA: A Monofunctional Peptidoglycan Transglycosylase

MtgA is a monofunctional peptidoglycan transglycosylase found in Chromohalobacter salexigens . Monofunctional PGTs possess only transglycosylase activity, unlike bifunctional PGTs that also have transpeptidase activity . MtgA is involved in the synthesis of peptidoglycan by catalyzing the glycosidic bond formation between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) residues .

MtgA in Peptidoglycan Biosynthesis

The biosynthesis of peptidoglycan is a multi-step process involving several enzymes that synthesize, modify, and assemble the PG structure . MtgA plays a role in the polymerization step, where it elongates the glycan chains by adding MurNAc-GlcNAc disaccharide units . These glycan chains are then cross-linked by transpeptidases to form the mature peptidoglycan layer .

Importance of Studying MtgA

Studying MtgA and other peptidoglycan biosynthetic enzymes is crucial for understanding bacterial cell wall synthesis and identifying potential targets for developing new antibacterial agents . Inhibiting MtgA activity can disrupt peptidoglycan synthesis, leading to cell wall weakening and bacterial cell death .

Lytic Transglycosylases

Lytic transglycosylases are murein-degrading enzymes that degrade murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1 . The lytic transglycosylase putatively encoded by ORF22 allow the genome to cross the cell wall .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mtgA; Csal_1016; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-234
Protein Length
full length protein
Species
Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768)
Target Names
mtgA
Target Protein Sequence
MTRDWLRRGLRFLLFAMLGFVGLSVLLVLVFRVVPVFGSMVMLERKVESWVSGEPVSIQQ QWRPWNALSDNAKLAVIASEDQRFPMHHGFDFNQMQKALDAWFSGDSLRGASTISQQTAK NLFLWTDRSWVRKGLEAWFTVLIELLWPKERILEVYLNIVEWDRGVFGLEAAAQHYFGVS ADRLSAAQASRLAAILPNPREWSASRPSSYIVKRSQWIQRQMRQLGGSAYLERL
Uniprot No.

Target Background

Function

Function: Recombinant Chromohalobacter salexigens Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is a peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.

Database Links
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is mtgA and what role does it play in bacterial cells?

Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is an enzyme that catalyzes glycan chain elongation during bacterial cell wall formation. MtgA functions specifically in peptidoglycan synthesis, which is crucial for maintaining cell wall integrity and bacterial cell division. In bacterial systems like Escherichia coli, mtgA has been shown to localize at the division site in cells with specific peptidoglycan biosynthesis deficiencies, suggesting it plays a role in cell division processes . The enzyme performs a glycosyltransferase function, polymerizing peptidoglycan precursors to form the structural mesh of bacterial cell walls.

How does the amino acid sequence of Chromohalobacter salexigens mtgA influence its function?

The Chromohalobacter salexigens mtgA consists of 234 amino acids with the sequence beginning with MTRDWLRRGL and ending with QMRQLGGSAY LERL . This sequence contains specific structural elements that enable its glycosyltransferase activity, including catalytic domains necessary for binding peptidoglycan precursors and facilitating glycan chain elongation. The protein's transmembrane regions allow for its correct localization within the bacterial membrane, which is essential for its function in peptidoglycan synthesis.

Researchers should note that, as with other transglycosylases, specific conserved residues within the sequence are likely critical for catalytic activity, substrate binding, and protein-protein interactions with other divisome components. Alterations to these critical residues through site-directed mutagenesis can help determine their specific roles in catalysis.

What are the recommended storage conditions for Recombinant Chromohalobacter salexigens mtgA?

For optimal stability and activity retention, the recombinant mtgA protein should be stored according to these guidelines:

  • Working aliquots can be stored at 4°C for up to one week for ongoing experiments

  • For long-term storage, maintain at -20°C or -80°C

  • Avoid repeated freeze-thaw cycles as this significantly reduces protein activity

  • Consider adding cryoprotectants such as glycerol when preparing storage aliquots

  • When receiving the product, centrifuge the vial before opening to consolidate any dispersed protein material

These conditions help maintain the structural integrity and enzymatic activity of the recombinant protein for experimental use.

What methodologies can be used to study mtgA localization during cell division?

Several complementary techniques can be employed to investigate mtgA localization:

  • Fluorescent Protein Fusion Analysis: Constructing GFP-mtgA fusion proteins allows for real-time visualization of protein localization. This approach has successfully demonstrated that mtgA localizes at the division site in E. coli cells deficient in PBP1b with thermosensitive PBP1a . For Chromohalobacter salexigens mtgA, researchers should optimize codon usage for expression and consider the impact of halophilic conditions on fluorescent protein folding.

  • Immunofluorescence Microscopy: Using antibodies specific to mtgA can reveal its native localization without potential artifacts from protein fusion constructs. This technique is particularly valuable when studying co-localization with other divisome proteins.

  • Time-lapse Microscopy: This enables observation of dynamic changes in mtgA localization throughout the cell cycle, providing insights into when and how mtgA is recruited to the divisome.

  • Super-resolution Microscopy: Techniques such as PALM, STORM, or STED offer nanometer-scale resolution for more precise localization studies, revealing subtle patterns that conventional fluorescence microscopy might miss.

These techniques should be used in conjunction with appropriate controls, including cells lacking mtgA or expressing non-functional variants, to validate localization patterns.

How can I assess the glycosyltransferase activity of mtgA in vitro?

The glycosyltransferase activity of mtgA can be measured using these established methods:

  • Radiolabeled Substrate Assay: Using radiolabeled lipid II substrate (e.g., 14C-GlcNAc-labeled lipid II) in a reaction mixture containing:

    • 15% dimethyl sulfoxide

    • 10% octanol

    • 50 mM HEPES (pH 7.0)

    • 0.5% decyl-polyethylene glycol

    • 10 mM CaCl2

    The products can be separated and analyzed to quantify peptidoglycan polymerization. Previous studies with GFP-MtgA showed a 2.4-fold increase in peptidoglycan polymerization compared to control (26% versus 11% of lipid II used) .

  • Lysozyme Sensitivity Test: To confirm the nature of polymerized products, treatment with lysozyme should result in complete digestion of the peptidoglycan material .

  • Fluorescent Substrate Analogues: Using fluorescently labeled lipid II analogues allows for continuous monitoring of reaction kinetics without radioactivity.

  • HPLC or Mass Spectrometry Analysis: These techniques can characterize the polymer products to determine chain length distribution and modification patterns.

When designing these experiments, researchers should include appropriate controls, such as heat-inactivated enzyme, and carefully optimize reaction conditions, particularly considering the halophilic nature of Chromohalobacter salexigens mtgA.

What protein interactions have been identified for mtgA and how can they be studied?

Research on E. coli mtgA has identified interactions with key divisome proteins, suggesting similar interactions may exist for Chromohalobacter salexigens mtgA:

Interaction PartnerInteraction Strength*Method UsedReference
PBP3 (FtsI)10-fold above controlBacterial two-hybrid
FtsW37-fold above controlBacterial two-hybrid
FtsN20-fold above controlBacterial two-hybrid
Self-interaction (MtgA-MtgA)37-fold above controlBacterial two-hybrid

*As measured by β-galactosidase activity in a bacterial two-hybrid system relative to negative controls (~100 U/mg)

These interactions can be studied using several complementary techniques:

  • Bacterial Two-Hybrid System: This in vivo method has successfully demonstrated interactions between mtgA and divisome proteins. The method involves constructing fusion proteins with T18 and T25 fragments of adenylate cyclase, which restore enzyme activity when brought into proximity by interacting proteins .

  • Co-immunoprecipitation: This technique can confirm interactions in native or near-native conditions using antibodies against mtgA or epitope-tagged versions.

  • Förster Resonance Energy Transfer (FRET): Using fluorescently tagged proteins to measure energy transfer between closely associated proteins in living cells.

  • Surface Plasmon Resonance (SPR): This quantitative in vitro method can measure binding affinities and kinetics of purified protein interactions.

  • Protein Crosslinking: Chemical crosslinking followed by mass spectrometry can identify interaction interfaces between mtgA and its partners.

When conducting these studies, researchers should consider the membrane-associated nature of these proteins and optimize experimental conditions accordingly.

How can genomic enzymology tools help elucidate mtgA's role in metabolic pathways?

Genomic enzymology web tools can significantly enhance our understanding of mtgA's functional role:

  • Sequence Similarity Networks (SSNs): These networks group proteins by sequence similarity, helping researchers identify functionally related enzymes. By constructing an SSN for mtgA, researchers can identify potential functional analogs across different species and infer conservation of mechanism .

  • Genome Neighborhood Networks (GNNs): GNNs analyze genes located near mtgA in the genome to identify functionally related proteins that may participate in the same pathway. This approach has successfully uncovered distal gene clusters involved in related metabolic functions, as demonstrated in pathways like D-threitol catabolism in Mycobacterium smegmatis .

  • Integration of Experimental Data: Combining in silico predictions with experimental verification (e.g., gene deletion studies, metabolite profiling) can validate predicted pathway connections.

To apply these tools to Chromohalobacter salexigens mtgA:

  • Construct an SSN for the mtgA family to identify evolutionary relationships

  • Develop a GNN centered on mtgA to identify potential pathway partners

  • Analyze conserved gene neighborhoods across halophilic bacteria to identify halophile-specific pathways involving mtgA

This integrated approach can reveal unexpected connections between mtgA and other metabolic systems, particularly those related to adaptation to high-salt environments.

What is known about the role of mtgA in halophilic bacteria specifically?

Understanding mtgA's function in halophilic bacteria like Chromohalobacter salexigens requires consideration of their unique physiology:

  • Adaptation to Hypersaline Environments: Halophilic bacteria typically inhabit environments with high salt concentrations. Chromohalobacter salexigens, as a moderate halophile, has adapted its cellular machinery to function optimally under these conditions .

  • Cell Wall Modifications: Halophilic bacteria often exhibit modifications in their cell wall structure to withstand osmotic stress. MtgA may play a specialized role in incorporating these modifications during peptidoglycan synthesis.

  • Interaction with Salt-Adapted Proteins: The divisome components that interact with mtgA in halophiles likely possess adaptations for high-salt environments, potentially affecting interaction dynamics.

  • Environmental Distribution: Studies of microbial culturomics have shown that halophilic species can be found in unexpected environments, including the human gut microbiome, particularly in healthy individuals from regions with traditional high-salt diets . This raises interesting questions about the distribution and horizontal transfer of genes encoding proteins like mtgA.

Current research suggests that the loss of commensal halophilic species observed in certain conditions (such as severe acute malnutrition) might indicate ecological conditions unfavorable to these specialized bacteria . Further investigation of mtgA's role in these bacteria could provide insights into the metabolic abilities that allow them to colonize these niches.

What factors should be considered when designing experiments with recombinant Chromohalobacter salexigens mtgA?

When designing experiments with this recombinant protein, researchers should consider:

  • Salt Concentration Effects: As Chromohalobacter salexigens is a halophilic organism, its proteins often require moderate to high salt concentrations for optimal folding and activity. Experimental buffers should be optimized to reflect these conditions.

  • Transmembrane Nature: The mtgA protein contains transmembrane regions, making it challenging to work with in solution. Consider using detergents or membrane mimetics to maintain protein structure and function.

  • Enzyme Stability: The recombinant protein's stability may be compromised during purification and storage. Monitor activity at different time points and storage conditions to establish optimal handling protocols.

  • Expression System Compatibility: When expressing Chromohalobacter salexigens mtgA in heterologous systems, codon optimization may be necessary. Cell-free expression systems have been successfully used to produce active protein .

  • Substrate Availability: Ensure access to appropriate lipid II substrates for activity assays, which may need to be synthesized or sourced from specialized suppliers.

  • Control Experiments: Include appropriate controls such as heat-inactivated enzyme, known inhibitors of transglycosylases (e.g., moenomycin), and comparison with well-characterized homologs from model organisms.

How can I validate the specificity of mtgA's interaction with divisome proteins?

To validate the specificity of protein interactions:

  • Multiple Interaction Detection Methods: Confirm interactions using at least two independent techniques (e.g., bacterial two-hybrid plus co-immunoprecipitation) to reduce method-specific artifacts.

  • Domain Mapping: Identify specific domains responsible for interaction by creating truncated versions of mtgA and partner proteins. Previous work has shown that the transmembrane segment of proteins like PBP3 is required for interaction with mtgA .

  • Competition Assays: Use peptides corresponding to potential interaction interfaces to compete with the native interaction.

  • Negative Controls: Include non-interacting protein pairs as negative controls. The bacterial two-hybrid system involving combinations like T18-T25, T18-T25-X, and T25-T18-X (where X is any protein of interest) should be used as negative controls, as these typically show minimal reporter activation .

  • Functional Validation: Determine if disrupting the interaction affects cellular processes, such as cell division or peptidoglycan synthesis, using genetic approaches (e.g., site-directed mutagenesis of interaction interfaces).

  • Quantitative Analysis: Apply methods that provide quantitative measurements of interaction strength, such as isothermal titration calorimetry or microscale thermophoresis with purified proteins.

What are common challenges in assessing mtgA activity and how can they be addressed?

Researchers commonly encounter these challenges when working with mtgA:

  • Low Activity of Recombinant Protein:

    • Challenge: Recombinant mtgA may show reduced activity compared to native enzyme.

    • Solution: Optimize expression conditions, consider using cell-free expression systems as used for the commercially available protein , and ensure proper protein folding by including appropriate cofactors (e.g., calcium ions).

  • Substrate Limitations:

    • Challenge: Natural lipid II substrate is complex and difficult to obtain in large quantities.

    • Solution: Consider using simplified substrate analogs for initial screening, while validating key findings with the authentic substrate.

  • Detergent Interference:

    • Challenge: Detergents needed to solubilize membrane proteins may inhibit enzyme activity.

    • Solution: Screen multiple detergents at their critical micelle concentrations to identify those compatible with mtgA activity. Previous protocols have used 0.5% decyl-polyethylene glycol successfully .

  • Assay Sensitivity:

    • Challenge: Traditional methods may lack sensitivity to detect low levels of mtgA activity.

    • Solution: Employ amplification steps or highly sensitive detection methods such as fluorescently labeled substrates or coupled enzyme assays.

  • Distinguishing from Other Transglycosylases:

    • Challenge: Separating mtgA activity from other transglycosylases in complex systems.

    • Solution: Use specific inhibitors for other transglycosylases, or work with genetic knockouts when studying in vivo activity.

What emerging technologies might advance our understanding of mtgA function?

Several cutting-edge approaches hold promise for deeper insights into mtgA function:

  • Cryo-Electron Microscopy: High-resolution structural studies of mtgA alone and in complex with interaction partners could reveal the molecular basis of substrate recognition and catalysis, particularly in the context of the divisome complex.

  • Single-Molecule Enzymology: Techniques that monitor individual enzyme molecules could reveal heterogeneity in mtgA activity and processivity during glycan chain formation.

  • In-Cell NMR: This emerging technique could provide structural information about mtgA in its native cellular environment, offering insights into how cellular conditions affect its conformation and activity.

  • Microfluidic Cell Culture Systems: These systems allow precise control of environmental conditions, enabling the study of mtgA function under dynamically changing salt concentrations that mimic natural habitats of halophilic bacteria.

  • CRISPR-Based Genetic Screens: Comprehensive genetic interaction mapping could identify previously unknown functional relationships between mtgA and other cellular components in diverse bacterial species.

  • Machine Learning Approaches: Computational models trained on existing protein interaction data could predict novel binding partners for mtgA across different bacterial species and environmental conditions.

These technologies, used in combination with established biochemical and genetic approaches, have the potential to significantly expand our understanding of mtgA's role in bacterial cell wall biosynthesis, particularly in the context of halophilic adaptation.

How might understanding mtgA function contribute to broader research on bacterial adaptation to extreme environments?

Research on Chromohalobacter salexigens mtgA has implications beyond cell wall biosynthesis:

  • Halophilic Adaptation Mechanisms: Studying how mtgA functions in high-salt environments can provide insights into the molecular adaptations that enable proteins to maintain activity under extreme conditions. This knowledge has potential applications in protein engineering and biotechnology.

  • Microbial Ecology: Understanding the role of halophilic bacteria in various ecosystems, including unexpected niches like the human microbiome, could be informed by mtgA research. Studies have shown that halophilic species can be found in the gut microbiota, particularly in populations with traditional high-salt diets .

  • Evolutionary Biology: Comparative studies of mtgA across different bacterial species could illuminate the evolutionary pathways of adaptation to extreme environments, revealing whether similar molecular solutions have evolved independently.

  • Systems Biology: Integrating mtgA function into broader models of cell wall biosynthesis and division could enhance our understanding of these essential processes across diverse bacterial species.

By investing in comprehensive research on proteins like mtgA, scientists can develop a more nuanced understanding of the molecular basis of bacterial adaptation, with potential applications in fields ranging from synthetic biology to environmental microbiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.