Recombinant Chromohalobacter salexigens Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant nqrE

The Na⁺-translocating NADH:quinone reductase (NQR) complex is a respiratory enzyme in Chromohalobacter salexigens, a halophilic γ-proteobacterium. Subunit E (nqrE) is a critical component of this six-subunit membrane-bound complex (nqrABCDEF), which couples electron transfer from NADH to ubiquinone with the translocation of Na⁺ ions across cellular membranes . Recombinant nqrE is produced in Escherichia coli for structural, functional, and biotechnological studies, bypassing challenges associated with native protein purification .

Protein Properties

PropertyDetails
Gene LocusCsal_1573 (Genome accession: GCA_004102695)
Length206 amino acids (AA)
Molecular Weight~23 kDa (calculated from AA sequence)
Expression HostEscherichia coli (optimized for recombinant production)
TagsHis-tag (variable by production protocol)
Storage BufferTris-based buffer with 50% glycerol (stored at -20°C)

Role in the NQR Complex

  • Electron Transfer: nqrE contributes to the membrane-bound quinone oxidation site, facilitating electron transfer to ubiquinone .

  • Na⁺ Translocation: The NQR complex generates a sodium gradient, critical for maintaining cellular osmotic balance in high-salinity environments .

  • Iron Metabolism: NQR influences iron homeostasis, making it a potential target for antimicrobial therapies .

Production Methodology

Recombinant nqrE is synthesized via heterologous expression:

  1. Cloning: The nqrE gene is inserted into a plasmid vector.

  2. Expression: Transformed E. coli cells produce nqrE under controlled conditions (e.g., IPTG induction).

  3. Purification: Purified via affinity chromatography (His-tag) .

Research and Biotechnological Relevance

  • Structural Studies: Recombinant nqrE enables detailed analysis of NQR’s quinone-binding pocket and Na⁺ translocation mechanism .

  • Antibiotic Development: Targeting NQR’s Na⁺-pumping activity could disrupt pathogenic bacterial respiration .

  • Osmoregulation Insights: Studying nqrE aids in understanding how halophiles like C. salexigens adapt to extreme salinity .

Genomic Insights

  • Genome Size: C. salexigens ANJ207 has a 3.66 Mb genome with 3,406 genes .

  • Biosynthetic Pathways: The genome encodes ectoine synthesis genes, which are upregulated under high salinity, suggesting metabolic coordination with NQR activity .

Transcriptomic Adaptation

Under salt stress, C. salexigens upregulates genes for compatible solutes (e.g., glycine betaine) and stress-response proteins, indirectly supporting NQR’s role in maintaining cellular homeostasis .

Challenges and Future Directions

  • Purity and Stability: Recombinant nqrE requires optimized buffers to prevent aggregation and degradation .

  • Functional Assays: In vitro reconstitution of the NQR complex is challenging but critical for elucidating Na⁺-coupled electron transfer .

  • Biotechnological Potential: Directed evolution of nqrE could enhance thermostability for industrial applications, as demonstrated with C. salexigens uronate dehydrogenase .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them during order placement. We will endeavor to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for precise delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipment is preferred, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein using deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL. We suggest incorporating 5-50% glycerol (final concentration) and aliquotting for extended storage at -20°C/-80°C. Our standard glycerol final concentration is 50%. Customers may utilize this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquotting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specified tag type preference, please communicate it to us, and we will prioritize developing the designated tag.
Synonyms
nqrE; Csal_1573; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768)
Target Names
nqrE
Target Protein Sequence
MFEHYLSLFVKAVFVENMALAFFLGMCTFLAVSKKISSAIGLGIAVVVVLTITVPVNNLI LTYLLSEGALTWTGLEGASNIDLSFLGLLSYIGVIAALVQILEMFLDKFVPALYNALGVF LPLITVNCAILGASLFMVERSYDFGESVIYGAGAGVGWALAITALAGIREKLKYSDVPAS LQGLGITFITVGLMSLGFMSFSGIQL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two consecutive reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of C. salexigens nqrE protein?

The nqrE subunit from C. salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) is a transmembrane protein with UniProt accession number Q1QX82 . The protein consists of 206 amino acids with the sequence: MFEHYLSLFVKAVFVENMALAFFLGMCTFLAVSKKISSAIGLGIAVVVVLTITVPVNNLILTYLLSEGALTWTGLEGASNIDLSFLGLLSYIGVIAALVQILEMFLDKFVPALYNALGVFLPLITVNCAILGASLFMVERSYDFGESVIYGAGAGVGWALAITALAGIREKLKYSDVPASLQGLGITFITVGLMSLGFMSFSGIQL . Structural analysis suggests the presence of transmembrane domains consistent with its role in the membrane-bound Na(+)-translocating NADH-quinone reductase complex. Researchers should employ circular dichroism spectroscopy, X-ray crystallography, or cryo-electron microscopy to further characterize its three-dimensional structure and membrane topology.

What experimental systems are optimal for expressing recombinant C. salexigens nqrE?

For optimal expression of recombinant C. salexigens nqrE, E. coli-based expression systems similar to those used for Actinobacillus pleuropneumoniae Na(+)-NQR subunit E have proven effective . When designing expression constructs, researchers should consider:

  • Codon optimization for the host organism

  • Addition of affinity tags (His-tag systems have been successfully employed)

  • Use of inducible promoters (T7 or similar)

  • Growth conditions that accommodate membrane protein expression (reduced temperature post-induction, specialized media)

Successful expression has been achieved with C-terminal 6-His tagged constructs, which facilitate purification while minimizing interference with protein folding . For membrane proteins like nqrE, specialized E. coli strains such as C41(DE3) or C43(DE3) may improve expression yields by mitigating toxicity issues.

What purification strategies yield the highest purity and activity for nqrE?

To achieve high purity and activity of recombinant nqrE, implement the following methodological approach:

Purification StepMethodologyCritical Parameters
Cell LysisMechanical disruption or detergent-based methodsGentle conditions to preserve protein structure
Membrane IsolationUltracentrifugation (100,000×g, 1h)Temperature control (4°C) throughout process
SolubilizationMild detergents (DDM, LDAO, or C12E8)Detergent:protein ratio optimization
Affinity ChromatographyNi-NTA for His-tagged constructsImidazole gradient elution
Size ExclusionSuperdex 200 or similarDetergent-containing buffer
Quality AssessmentSDS-PAGE, Western blotConfirmation of size (34-40 kDa under reducing conditions)

For storage, lyophilization from a 0.2 μm filtered solution in PBS with trehalose has been effective for similar proteins . Reconstitution at 1.00 mg/mL in PBS is recommended prior to experimental use, with storage in a manual defrost freezer to avoid repeated freeze-thaw cycles .

How can researchers validate the functional activity of purified nqrE?

Validating the functional activity of purified nqrE requires a multi-faceted approach:

  • Spectroscopic Assays: Monitor NADH oxidation at 340 nm in the presence of various quinone acceptors.

  • Sodium Transport Assays: Measure Na+ transport using fluorescent indicators (e.g., SBFI) in reconstituted proteoliposomes.

  • Protein-Protein Interaction Studies: Assess interaction with other Na(+)-NQR subunits using pull-down assays or surface plasmon resonance.

  • Complementation Assays: Express nqrE in nqrE-deficient bacterial strains to confirm functional restoration.

It's important to note that nqrE functions as part of the larger Na(+)-NQR complex, so full activity assessment may require co-expression with other subunits. The complex typically catalyzes the reaction: NADH + quinone + 2Na+(in) → NAD+ + quinol + 2Na+(out), with EC classification 1.6.5.- .

What are the physiological roles of Na(+)-NQR in C. salexigens and other halophilic bacteria?

The Na(+)-translocating NADH-quinone reductase complex, including the nqrE subunit, plays several crucial roles in C. salexigens:

  • Energy Conservation: Couples NADH oxidation to Na+ translocation, contributing to the generation of a sodium motive force used for ATP synthesis, especially in high-salt environments.

  • Osmoadaptation: Contributes to C. salexigens' remarkable salt tolerance (the organism has been extensively studied for osmoadaptation processes) .

  • Redox Balance: Maintains cellular redox homeostasis under varying salinity conditions.

As a moderately halophilic bacterium with exceptional salinity growth range, C. salexigens likely utilizes Na(+)-NQR as part of its adaptation mechanism to high-salt environments . Researchers investigating these physiological roles should design experiments comparing Na(+)-NQR activity across different salt concentrations (0.5-3.0 M NaCl) and correlate enzyme activity with growth parameters and cellular energetics.

What genomic and evolutionary patterns are observed for nqrE in halophilic bacteria?

The nqrE gene (locus Csal_1573) in C. salexigens shows evolutionary patterns that may reflect adaptation to halophilic environments . Based on patterns observed with other proteins in C. salexigens:

  • Genomic proximity analysis would likely reveal clustering with other Na(+)-NQR subunit genes in an operon structure.

  • Comparative genomics may show conservation patterns similar to those observed for ectoine synthesis genes in Oceanospirillales and Alteromonadales .

  • Evolutionary analysis might reveal directional divergence patterns resulting from adaptation to specific ecological niches.

The evolutionary trajectory of nqrE likely parallels that observed for ectoine hydroxylases, where C. salexigens proteins clustered with orthologs from related halophilic bacteria including Halomonas, Cobetia, and Alcalinivorax species . Researchers should employ phylogenetic analysis using maximum likelihood methods to construct evolutionary trees of nqrE across diverse bacterial species.

How does the structure of nqrE contribute to Na+ translocation mechanisms?

Understanding how nqrE contributes to Na+ translocation requires detailed structure-function analysis:

  • Transmembrane Domain Analysis: The amino acid sequence of C. salexigens nqrE (MFEHYLSLFVKAVFVENMALAFFLGMCTFLAVSK...) suggests multiple transmembrane helices . Site-directed mutagenesis of conserved residues within these domains would identify amino acids essential for Na+ coordination and translocation.

  • Na+-Binding Site Identification: Computational modeling combined with experimental validation through 22Na+ binding assays can identify specific Na+-binding motifs. Researchers should focus on acidic and polar residues within transmembrane segments.

  • Conformational Changes: Using techniques such as hydrogen-deuterium exchange mass spectrometry or FRET-based approaches, investigators can map conformational changes associated with Na+ binding and translocation.

  • Subunit Interfaces: The interaction between nqrE and other Na(+)-NQR subunits likely creates channels for Na+ movement. Cross-linking studies combined with mass spectrometry can identify these critical interface regions.

The proposed Na+ pathway likely involves a series of coordinated conformational changes triggered by electron transfer through the complex, with nqrE providing part of the translocation channel.

What experimental approaches can reveal the assembly and membrane integration of the Na(+)-NQR complex?

Investigating the assembly and membrane integration of the Na(+)-NQR complex containing nqrE requires sophisticated experimental approaches:

  • In vitro Reconstitution: Purified nqrE and other Na(+)-NQR subunits can be reconstituted into liposomes to study complex formation. Varying lipid composition can reveal lipid requirements for proper assembly.

  • Time-resolved Assembly Analysis: Pulse-chase experiments with radioactively labeled subunits can track the temporal sequence of complex assembly.

  • Interaction Mapping: Chemical cross-linking followed by mass spectrometry analysis can identify precise interaction points between nqrE and other subunits.

  • Cryo-electron Microscopy: Single-particle analysis of purified complexes can reveal the structural arrangement of subunits, including nqrE's position and orientation.

  • Cellular Localization: Fluorescently tagged nqrE can be tracked in vivo to monitor its localization and incorporation into the complex.

These approaches should be implemented under varying salt concentrations relevant to C. salexigens' natural environment to understand how environmental conditions affect complex assembly.

How can nqrE be used to investigate bacterial adaptation to extreme environments?

The nqrE subunit provides a valuable molecular tool for investigating bacterial adaptation to extreme environments:

  • Comparative Bioenergetics: Researchers can compare Na(+)-NQR activity and expression levels in C. salexigens grown under different stress conditions (salt, temperature, pH) to understand bioenergetic adaptations.

  • Heterologous Expression: Expressing C. salexigens nqrE in non-halophilic bacteria and assessing phenotypic changes can reveal its contribution to salt tolerance.

  • Mutant Analysis: Creating nqrE point mutations or deletions in C. salexigens and measuring growth parameters across salinity gradients can establish structure-function relationships relevant to halotolerance.

  • Transcriptomic Integration: Correlating nqrE expression patterns with other stress-response genes (such as those involved in ectoine synthesis ) can uncover regulatory networks underlying halophilic adaptation.

  • Evolution Experiments: Laboratory evolution experiments under increasing salt stress, followed by genomic analysis focusing on nqrE mutations, can reveal adaptive trajectories.

How can recombinant nqrE be used as a tool for studying membrane protein interactions?

Recombinant nqrE can serve as a model system for studying membrane protein interactions through several methodological approaches:

  • BiFC (Bimolecular Fluorescence Complementation): Fusing split fluorescent protein fragments to nqrE and potential interaction partners can visualize interactions in vivo.

  • Pull-down Proteomics: His-tagged nqrE can be used as bait in pull-down experiments followed by mass spectrometry to identify novel interaction partners.

  • Nanodiscs Reconstitution: Incorporating nqrE into nanodiscs provides a native-like membrane environment for studying interactions with lipids and other proteins using techniques like surface plasmon resonance.

  • FRET-based Assays: Fluorescently labeled nqrE can be used in FRET experiments to measure distance changes during protein-protein interactions or conformational shifts.

These approaches can reveal fundamental principles of membrane protein assembly and interaction that extend beyond Na(+)-NQR complexes to other membrane protein systems.

What methodological challenges must be addressed when studying Na(+)-NQR activity in cell-free systems?

Researchers studying Na(+)-NQR activity in cell-free systems must address several methodological challenges:

ChallengeTechnical SolutionValidation Method
Maintaining membrane integrityUse of gentle detergents (DDM) or nanodiscsElectron microscopy verification
Preserving native lipid environmentLipid extraction and reconstitution from C. salexigensThin-layer chromatography analysis
Stability of the multi-subunit complexCo-expression of all subunits with appropriate tagsBlue native PAGE verification
Replicating physiological Na+ gradientsCarefully designed proteoliposome assaysNa+-sensitive fluorescent probes
Controlling redox stateDefined ratios of NAD+/NADH and oxidized/reduced quinonesSpectrophotometric monitoring

Additionally, researchers must consider the impact of temperature and salt concentration on complex stability, as C. salexigens shows differential accumulation of compatible solutes under varying conditions . Activity assays should be performed across a range of physiologically relevant conditions (30-45°C, 0.5-3.0 M NaCl).

How do post-translational modifications affect nqrE function in C. salexigens?

While specific information about post-translational modifications (PTMs) of C. salexigens nqrE is limited in the provided search results, researchers investigating this aspect should:

  • Mass Spectrometry Analysis: Employ high-resolution MS to identify potential PTMs such as phosphorylation, glycosylation, or lipid modifications.

  • Site-Directed Mutagenesis: Mutate putative modification sites and assess functional consequences on Na+ translocation activity.

  • Environmental Response: Analyze changes in PTM patterns under different growth conditions (salt concentration, temperature, growth phase) to correlate modifications with environmental adaptation.

  • PTM Enzymes: Identify and characterize enzymes responsible for nqrE modifications through co-immunoprecipitation and activity assays.

This research direction is particularly relevant given C. salexigens' remarkable adaptability to varying salinity and temperature conditions , suggesting sophisticated regulatory mechanisms that may include PTM-based control of Na(+)-NQR activity.

How might synthetic biology approaches utilize nqrE to engineer salt-tolerant microorganisms?

Synthetic biology applications of nqrE could enable the engineering of salt-tolerant microorganisms through:

  • Modular Expression Systems: Developing tunable expression cassettes containing the complete Na(+)-NQR operon, including optimized nqrE, for transfer to non-halophilic bacteria.

  • Chimeric Na+ Pumps: Creating fusion proteins or chimeric complexes incorporating domains from C. salexigens nqrE into other bacterial respiratory complexes to enhance Na+ pumping capabilities.

  • Co-expression Strategies: Combining nqrE with compatible solute synthesis pathways (like the ectoine synthesis system also found in C. salexigens ) to create microorganisms with enhanced salt tolerance.

  • Directed Evolution: Applying directed evolution to nqrE to enhance its stability or activity under specific industrial conditions.

The methodological approach should include stepwise implementation and validation of each component, followed by comprehensive phenotypic and bioenergetic characterization of the engineered strains across salt concentration gradients.

What is the relationship between Na(+)-NQR activity and other stress response mechanisms in C. salexigens?

Investigating the relationship between Na(+)-NQR activity and other stress response mechanisms requires an integrated systems biology approach:

  • Transcriptomic Correlation: RNA-seq analysis comparing expression patterns of nqrE with other stress-response genes, particularly those involved in osmoadaptation and compatible solute synthesis like ectoine and hydroxyectoine pathways .

  • Metabolic Flux Analysis: Tracking changes in cellular energetics and central metabolism when Na(+)-NQR is inhibited under various stress conditions.

  • Regulatory Network Mapping: ChIP-seq or similar approaches to identify transcription factors that co-regulate nqrE and other stress response genes.

  • Comparative Stress Responses: Analyzing Na(+)-NQR activity under different stressors (salt, temperature, pH, oxidative stress) to identify stress-specific patterns.

Given that C. salexigens accumulation of hydroxyectoine is upregulated by both salinity and temperature (maximal at 45°C and 2.5 M NaCl) , there may be coordinated regulation between Na(+)-NQR activity and compatible solute synthesis under combined stress conditions.

How can structural insights from nqrE inform the development of new antimicrobial compounds?

Structural and functional characterization of nqrE can inform antimicrobial development through:

  • Inhibitor Design: Identifying unique structural features of bacterial Na(+)-NQR complexes that can be targeted by small-molecule inhibitors, disrupting bacterial bioenergetics.

  • Specificity Determination: Comparing nqrE from pathogenic and non-pathogenic species to design inhibitors selective for pathogen-specific features.

  • Structure-based Virtual Screening: Using solved structures of nqrE to conduct in silico screening of compound libraries for potential inhibitors.

  • Allosteric Site Identification: Identifying non-conserved allosteric sites that could be targeted to disrupt complex assembly rather than direct catalytic inhibition.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.