Recombinant Chromohalobacter salexigens NADH-quinone oxidoreductase subunit A (nuoA)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us; we will prioritize its development.
The tag type is determined during the production process. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
nuoA; Csal_3132; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768)
Target Names
nuoA
Target Protein Sequence
MTDEATALIAQYWATGLFIIAVFALCALMIGAASLLGGRSRGPSKSLPFESGVVGTGSAR
QRFSVKFYLVAMLFVIFDIEAVFLFAWAVSVREVGWEGFAGAAVFIFILLAGLVYDSRVG
ALEWAPRKRGRSPDIVTQR
Uniprot No.
Target Background
Function
NDH-1, a NADH-quinone oxidoreductase, facilitates electron transfer from NADH to quinones within the respiratory chain via FMN and iron-sulfur (Fe-S) centers. In this species, ubiquinone is believed to be the primary electron acceptor. This process is coupled to proton translocation, with four hydrogen ions translocated across the cytoplasmic membrane for every two electrons transferred. This conserves redox energy as a proton gradient.
Database Links
KEGG: csa:Csal_3132
STRING: 290398.Csal_3132
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
