Recombinant Chromohalobacter salexigens NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
nuoK; Csal_3123; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768)
Target Names
nuoK
Target Protein Sequence
MNGIPMEHGLILASILFALGLVGLMMRRNMLFVLMSLEIMMNSAGLAFIVAGTRWGQPDG QVMFLLVITLAAAEASVGLALLLQLYRRFKTLDIDAASRLRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this particular species, ubiquinone is believed to be the immediate electron acceptor for the enzyme. The enzyme couples the redox reaction with proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of NADH-quinone oxidoreductase subunit K (nuoK) in Chromohalobacter salexigens?

NADH-quinone oxidoreductase subunit K (nuoK) is a membrane-embedded component of respiratory Complex I in Chromohalobacter salexigens. It plays a crucial role in energy conservation through proton translocation across the membrane during electron transfer from NADH to quinone. In C. salexigens, nuoK functions within one of three types of respiratory NADH dehydrogenases whose expression varies depending on salinity and temperature conditions, suggesting its importance in osmotic and thermal adaptation mechanisms . The protein contributes to the generation of the electrochemical gradient that powers ATP synthesis and maintains ion homeostasis, which is particularly important for this halophilic bacterium's survival in high-salt environments where energy-demanding compatible solute production is necessary.

How does the expression of nuoK vary with salinity and temperature in C. salexigens?

Transcriptomic analyses have revealed that C. salexigens modulates the expression of its respiratory chain components, including NADH dehydrogenase genes, in response to changing environmental conditions. When exposed to different salinity levels (0.6 M NaCl vs 2.5 M NaCl) and temperatures (37°C vs 45°C), C. salexigens exhibits a transcriptional shift in genes encoding respiratory NADH dehydrogenases . Specifically, quantitative RNA-seq analysis shows that nuoK expression patterns correlate with the bacterium's adaptation to osmotic and thermal stresses. This modulation appears to be part of a larger strategy to maintain energy production and ion gradients under challenging environmental conditions that trigger the synthesis of compatible solutes like ectoine and hydroxyectoine .

What structural features characterize the nuoK subunit in C. salexigens?

The nuoK subunit in C. salexigens is characterized by multiple transmembrane helices that anchor it within the membrane domain of the NADH-quinone oxidoreductase complex. Like its counterparts in other bacteria, C. salexigens nuoK contains conserved charged residues that are essential for proton translocation. These residues form part of the proton channel through which H+ ions are pumped from the cytoplasm to the periplasm. The protein's specific structural adaptations may contribute to the halophilic nature of C. salexigens, potentially featuring an abundance of acidic residues on its surface - a common characteristic of proteins from halophilic organisms that helps maintain protein solubility and stability in high-salt environments .

How does nuoK contribute to ion homeostasis in C. salexigens?

The nuoK subunit, as part of the NADH-quinone oxidoreductase complex, contributes significantly to ion homeostasis in C. salexigens through its role in establishing the proton gradient across the membrane. This gradient is intricately connected to Na+ homeostasis, as research has shown that C. salexigens maintains remarkably constant intracellular Na+ content regardless of external salinity and temperature . The proton gradient generated with the help of nuoK likely energizes Na+/H+ antiporters and sodium-solute symporters, systems whose genes show transcriptional shifts depending on environmental conditions. These ion transport systems are crucial for maintaining appropriate intracellular ion concentrations while allowing the bacterium to thrive in high-salt environments and produce valuable compatible solutes like ectoine .

What are the specific amino acid adaptations in C. salexigens nuoK that enable function under high salinity?

An in-depth analysis of C. salexigens nuoK reveals several key amino acid adaptations that enable its functionality under high salinity conditions. Unlike mesophilic counterparts, C. salexigens nuoK likely features a higher proportion of acidic amino acids (Asp, Glu) on solvent-exposed surfaces, reduced hydrophobic amino acids, and increased negative surface charge. These adaptations help maintain proper protein folding and prevent aggregation in high-salt environments by enhancing solvation and repelling similarly charged proteins. Additionally, strategic positioning of basic residues (Lys, Arg) may create stabilizing salt bridges within the protein structure. The transmembrane regions likely contain amino acids that facilitate interaction with the altered membrane composition found in halophilic bacteria adapting to osmotic stress .

The table below compares predicted amino acid composition differences between C. salexigens nuoK and a model mesophilic homolog:

Amino Acid CategoryC. salexigens nuoKMesophilic HomologAdaptive Significance
Acidic (Asp, Glu)Higher %Lower %Increased hydration, salt binding
Basic (Lys, Arg)Strategic placementDistributedSalt bridge formation
HydrophobicReduced %Higher %Decreased aggregation tendency
Polar unchargedSlightly higher %Moderate %Enhanced solvation
Transmembrane regionsSpecialized residuesStandard hydrophobicAdaptation to altered membrane properties

How does recombinant nuoK interact with Na+/H+ antiporters in engineered expression systems?

Recombinant nuoK in engineered expression systems interfaces with Na+/H+ antiporters through their shared involvement in maintaining cellular ion homeostasis. Research using specific ionophores that disturb Na+ and H+ gradients has demonstrated that both gradients influence ectoine production, though with variations depending on solute, salinity, and temperature conditions . When expressing recombinant nuoK, researchers should consider that the protein's activity contributes to the proton motive force that drives antiporter function.

In experimental systems, co-expression of nuoK with Na+/H+ antiporters from C. salexigens allows investigation of their functional coupling. When specific Na+ ionophores (such as ET2120) and H+ ionophores (such as 3,3′,4′,5-tetrachlorosalicylanilide, TCS) are applied at concentrations of 30 μM and 0.1 μM respectively, significant alterations in cell physiology and compatible solute production are observed . This methodology provides valuable insights into how recombinant nuoK contributes to the respiratory chain's role in establishing ion gradients that support cellular function in high-salt environments.

What is the relationship between nuoK function and compatible solute production in C. salexigens?

The function of nuoK in C. salexigens shows a significant correlation with compatible solute production, particularly ectoine and hydroxyectoine. As part of the respiratory chain, nuoK contributes to energy conservation and the generation of ion gradients that support the energy-demanding processes of compatible solute synthesis and accumulation. Quantitative RNA-seq analysis has revealed that transcriptional shifts in respiratory chain components, including NADH dehydrogenases, coincide with changes in compatible solute production under varying salinity and temperature conditions .

The relationship appears bidirectional: nuoK activity supports the energetic requirements for compatible solute production, while accumulated compatible solutes may help maintain nuoK functionality under stress conditions. Experimental disruption of ion gradients using specific ionophores has demonstrated that both Na+ and H+ gradients influence ectoine production, with variations depending on environmental conditions . This suggests that nuoK's contribution to establishing these gradients directly impacts the cell's ability to synthesize protective compatible solutes when facing osmotic and thermal stress.

How do mutations in conserved residues of nuoK affect proton translocation and energy conservation in C. salexigens?

Mutations in conserved residues of nuoK significantly impact proton translocation and energy conservation in C. salexigens, with cascading effects on the organism's ability to adapt to osmotic and thermal stress. Highly conserved charged residues within the transmembrane helices of nuoK form part of the proton channel and are essential for H+ translocation. Site-directed mutagenesis studies typically reveal that replacing these key residues with neutral amino acids substantially reduces proton pumping efficiency and consequently diminishes the proton motive force.

In the context of C. salexigens, such mutations would be expected to compromise energy conservation, impacting ATP synthesis and the energy-dependent production of compatible solutes like ectoine and hydroxyectoine. Given that C. salexigens modulates its respiratory chain components in response to salinity and temperature , mutations in nuoK would likely disrupt this adaptive response, potentially rendering the organism more vulnerable to environmental stress. The severity of these effects would vary based on the specific residue mutated and the alternative respiratory pathways available to compensate for reduced Complex I efficiency.

What expression systems are most suitable for producing recombinant C. salexigens nuoK?

For producing recombinant C. salexigens nuoK, carefully selected expression systems must accommodate the halophilic nature of this membrane protein. An E. coli C41(DE3) or C43(DE3) expression system using a pET vector with a T7 promoter provides a robust platform for initial production trials. These strains are specifically engineered for toxic and membrane protein expression. The expression protocol should include induction with 0.5 mM IPTG at mid-log phase (OD₆₀₀ = 0.6) and growth at 30°C rather than 37°C to enhance proper protein folding.

For more native-like conditions, consider using Halomonas elongata as an expression host, as it shares compatible solute production capabilities with C. salexigens. The expression medium should contain 0.6-2.5 M NaCl to mimic the salinity conditions where C. salexigens naturally expresses nuoK . For optimal results, supplement the medium with 20 mM glucose as the carbon source, following protocols established for C. salexigens growth . Expression yield can be monitored via Western blotting with antibodies directed against a C-terminal His-tag, avoiding N-terminal tagging which might interfere with membrane insertion.

What purification strategies yield the highest activity for recombinant nuoK protein?

Purification of recombinant nuoK from C. salexigens requires specialized approaches to maintain the integrity and activity of this membrane protein. The optimal purification strategy involves a two-step detergent-based extraction followed by affinity chromatography under high-salt conditions. Initial solubilization should be performed using 1% n-dodecyl-β-D-maltoside (DDM) in buffer containing 0.5-1.0 M NaCl to mimic the halophilic environment of C. salexigens, with gentle agitation for 2 hours at 4°C.

For chromatographic purification, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is recommended for His-tagged nuoK, with all buffers maintaining 0.05% DDM and appropriate salt concentration. A stepwise imidazole gradient (50 mM, 100 mM, 250 mM, and 500 mM) allows selective elution. Size exclusion chromatography as a polishing step significantly improves protein homogeneity. Throughout purification, maintain buffer pH at 7.2 (consistent with C. salexigens optimal growth conditions) and include 10% glycerol to enhance protein stability. Activity assays should be performed immediately post-purification, as freeze-thaw cycles substantially reduce nuoK activity.

How can researchers accurately assess nuoK contribution to respiratory chain function in C. salexigens?

Accurately assessing nuoK contribution to respiratory chain function in C. salexigens requires a multi-faceted approach combining genetic, biochemical, and biophysical methods. Begin with the construction of a nuoK deletion mutant using allelic exchange techniques, ensuring complete removal of the gene while maintaining operon integrity. Comparatively analyze growth kinetics of wild-type and ΔnuoK strains under varying salinity (0.6 M and 2.5 M NaCl) and temperature conditions (37°C and 45°C) to establish phenotypic consequences .

For quantitative assessment of respiratory activity, measure oxygen consumption rates using a Clark-type electrode in membrane preparations from both strains, with NADH as the electron donor and ubiquinone as the acceptor. Complement this with proton translocation assays using ACMA (9-amino-6-chloro-2-methoxyacridine) fluorescence quenching to directly measure proton pumping efficiency. Additionally, determine intracellular ATP levels using a luciferase-based assay to evaluate energy conservation capability.

To isolate nuoK contribution from other NADH dehydrogenases, use specific inhibitors like rotenone for Complex I, along with the Na+ ionophore ET2120 (30 μM) and H+ ionophore TCS (0.1 μM) to disturb ion gradients while monitoring changes in respiratory parameters. Correlate these measurements with transcriptomic data on nuoK expression under identical conditions to establish meaningful structure-function relationships.

What protocols are recommended for analyzing nuoK membrane topology and interaction with other respiratory complex subunits?

For comprehensive analysis of nuoK membrane topology and subunit interactions, researchers should employ a complementary set of structural and biochemical techniques. Begin with computational prediction of transmembrane domains using specialized algorithms like TMHMM, HMMTOP, and TOPCONS, cross-validating results to establish a consensus topology model. Experimentally validate this model using the substituted cysteine accessibility method (SCAM), wherein single cysteines are introduced at predicted loop regions and their accessibility to membrane-impermeable sulfhydryl reagents is assessed.

For defining subunit interactions, implement both chemical crosslinking and blue native PAGE approaches. Use membrane-permeable crosslinkers like DSS (disuccinimidyl suberate) at varying concentrations (0.1-2.0 mM) and reaction times (5-30 minutes) to capture transient protein-protein interactions. Extract crosslinked complexes using the established detergent protocol and identify interaction partners via mass spectrometry. Blue native PAGE provides complementary information on intact respiratory complexes, allowing visualization of subcomplexes that may form in the absence of nuoK.

For higher-resolution structural analysis, purify the entire NADH-quinone oxidoreductase complex from both wild-type and nuoK-complemented strains using affinity tags, followed by single-particle cryo-electron microscopy. This approach can reveal how nuoK integrates into the larger complex and potentially identify conformational changes associated with varying salinity conditions that reflect C. salexigens adaptation mechanisms .

How does nuoK activity correlate with osmotic and thermal stress response in C. salexigens?

The activity of nuoK shows significant correlation with osmotic and thermal stress responses in C. salexigens, functioning as part of the adaptive machinery that enables this moderately halophilic bacterium to thrive in challenging environments. Quantitative RNA-seq analysis has revealed that genes encoding respiratory chain components, including NADH dehydrogenases, undergo transcriptional shifts in response to varying salinity (0.6 M vs 2.5 M NaCl) and temperature (37°C vs 45°C) conditions . These shifts likely reflect adjustments in energy metabolism necessary to support the production of compatible solutes like ectoine and hydroxyectoine, which protect the cell against osmotic and thermal stress.

The correlation between nuoK activity and stress response can be observed through oxygen consumption rates and membrane potential measurements under different salinity and temperature conditions. These parameters directly reflect respiratory chain function and energy conservation capability. Additionally, disturbance of ion gradients using specific ionophores has demonstrated that both Na+ and H+ gradients, which nuoK helps establish, influence ectoine production differently depending on environmental conditions . This indicates that nuoK's contribution to establishing these gradients is an integral part of the complex stress response mechanism in C. salexigens.

What comparative insights can be gained by studying nuoK across different Chromohalobacter species?

Comparative analysis of nuoK across different Chromohalobacter species provides valuable insights into the evolution and adaptation of respiratory chain components in halophilic bacteria. While detailed studies of compatible solute production exist for C. salexigens, information about other Chromohalobacter species remains limited . By extending nuoK research to include species like C. japonicus, researchers can identify conserved features essential for function versus adaptations specific to particular ecological niches.

Sequence alignment of nuoK from multiple Chromohalobacter species reveals conservation patterns in transmembrane domains and functionally critical residues. Species-specific variations may correlate with differences in salt tolerance, temperature range, or compatible solute profiles. For instance, C. japonicus shows a unique combination of compatible solutes including ectoine, glutamate, NADA, alanine, trehalose, hydroxyectoine, and valine when grown at 5% NaCl and 28°C , potentially reflecting different energy requirements and respiratory chain adaptations compared to C. salexigens.

Cross-species functional complementation studies, where nuoK from one species is expressed in a nuoK deletion mutant of another species, can directly test the functional equivalence of these proteins. Such approaches help identify critical adaptations in nuoK that contribute to the specific halophilic lifestyle of each Chromohalobacter species, informing our broader understanding of respiratory chain evolution in extremophiles.

How can recombinant nuoK be utilized to engineer salt tolerance in non-halophilic bacterial strains?

Recombinant nuoK from C. salexigens represents a valuable tool for engineering enhanced salt tolerance in non-halophilic bacterial strains, particularly when incorporated as part of a comprehensive approach addressing energy metabolism and ion homeostasis. The strategic integration of C. salexigens nuoK into the respiratory chain of host organisms must consider several factors to achieve functional expression and salt tolerance enhancement.

The experimental approach should begin with codon-optimized nuoK gene synthesis for the target host, ensuring appropriate translation efficiency. Expression should be controlled by inducible promoters to prevent metabolic burden during initial growth phases. For successful membrane integration, the gene should be co-expressed with appropriate chaperones or include fusion partners that facilitate membrane targeting.

Engineering salt tolerance requires more than just nuoK expression; complementary components should include Na+/H+ antiporters from C. salexigens to maintain ion homeostasis, as well as compatible solute synthesis pathways. Successful integration might be validated through respiratory activity measurements using membrane preparations, demonstrating enhanced NADH oxidation under high-salt conditions compared to unmodified strains.

Expected outcomes include measurable improvements in growth rates, biomass accumulation, and survival at elevated NaCl concentrations (typically 3-10% depending on the baseline tolerance of the host). The most promising applications lie in biotechnology sectors requiring salt-tolerant production strains, particularly for bioremediation in saline environments or industrial fermentation processes using non-potable water sources.

What role does iron homeostasis play in nuoK function and how does it relate to ectoine production?

Iron homeostasis plays a crucial yet complex role in nuoK function and ectoine production in C. salexigens, with significant implications for respiratory chain efficiency and osmoadaptation. NADH-quinone oxidoreductase (Complex I), which includes the nuoK subunit, contains multiple iron-sulfur clusters essential for electron transfer. The proper assembly and function of this complex therefore depends on adequate iron availability, linking iron homeostasis directly to respiratory efficiency and energy conservation.

These findings suggest a regulatory connection between iron availability, respiratory chain function (including nuoK activity), and compatible solute production. Iron likely influences nuoK function through its role in Fe-S cluster formation, affecting electron transfer efficiency and proton translocation capability. This in turn impacts the energy available for compatible solute synthesis and the establishment of ion gradients that support osmoadaptation. The dual effect of iron on hydroxyectoine accumulation versus total ectoine content under different stress conditions highlights the intricate balance between iron homeostasis, energy metabolism, and osmotic adaptation mechanisms in C. salexigens.

What emerging technologies could advance our understanding of nuoK structure-function relationships?

Emerging technologies offer unprecedented opportunities to elucidate nuoK structure-function relationships in C. salexigens. Cryo-electron microscopy (cryo-EM) advances now permit visualization of membrane proteins at near-atomic resolution without crystallization, enabling researchers to capture nuoK in different conformational states relevant to its proton translocation function. This approach could reveal how nuoK's structure adapts to varying salinity and temperature conditions characteristic of C. salexigens' natural environment .

Single-molecule Förster resonance energy transfer (smFRET) represents another promising technology for studying nuoK dynamics. By strategically placing fluorophore pairs on nuoK and monitoring energy transfer efficiency, researchers can track conformational changes during the catalytic cycle in real-time, providing insights into how proton translocation couples with electron transfer in this halophilic system.

Hydrogen-deuterium exchange mass spectrometry (HDX-MS) could identify regions of nuoK that undergo structural changes in response to different salt concentrations, pinpointing domains critical for halophilic adaptation. Combined with molecular dynamics simulations incorporating appropriate membrane compositions and salt concentrations, these approaches would generate comprehensive models of nuoK function under the osmotic and thermal stress conditions where C. salexigens naturally thrives.

How might systems biology approaches integrate nuoK function into whole-cell models of C. salexigens?

Systems biology approaches offer powerful frameworks for integrating nuoK function into comprehensive whole-cell models of C. salexigens, elucidating its role within the broader context of halophilic adaptation. Constraint-based metabolic modeling, incorporating genome-scale metabolic reconstruction with detailed respiratory chain components, can quantitatively predict how nuoK activity influences cellular energetics under varying environmental conditions. By integrating transcriptomic data showing differential expression of respiratory chain components at different salinities and temperatures , flux balance analysis can estimate the energetic consequences of nuoK modulation and its impact on compatible solute production.

Multi-omics data integration represents another valuable approach. Combining proteomics to track nuoK abundance, phosphoproteomics to identify regulatory modifications, metabolomics to monitor energy metabolites and compatible solutes, and transcriptomics to capture gene expression changes enables construction of regulatory networks connecting nuoK activity to cellular responses. This integration would reveal how nuoK functions within feedback loops controlling respiratory efficiency, ion homeostasis, and osmoadaptation.

Agent-based modeling could further simulate how individual nuoK-containing respiratory complexes contribute to establishing membrane potential and ion gradients under various stress conditions. These models would incorporate experimental data on how disturbance of these gradients affects ectoine production , providing a mechanistic understanding of nuoK's role in C. salexigens' remarkable ability to thrive in challenging environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.