Recombinant Chromohalobacter salexigens Probable intracellular septation protein A (Csal_0706)

Shipped with Ice Packs
In Stock

Description

Overview of Csal_0706

Biological Role:

  • Function: Facilitates intracellular septation during bacterial cell division .

  • Organism: Derived from Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138), a halophilic γ-proteobacterium known for extreme salt tolerance .

  • Gene Context: Located in a genome optimized for high GC content (61.3%) and codon usage favoring salt-stress adaptation .

Recombinant Production:

  • Expression System: Produced via cell-free expression systems with Tris-based storage buffers and glycerol .

  • Purity: ≥85% purity confirmed by SDS-PAGE .

  • Storage: Stable at -20°C to -80°C; repeated freeze-thaw cycles are discouraged .

Table 1: Key Attributes of Recombinant Csal_0706

PropertyValue
UniProt IDQ1QZP1
Amino Acid Sequence189 residues (1–189 aa)
Molecular Weight21.5 kDa
Isoelectric Point (pI)Predicted 5.2 (computational tools)
DomainsTransmembrane regions critical for septation

3D Structure:

  • AlphaFold Model: A computed structure (AF-Q1QZP1-F1) predicts a compact fold with high confidence (global pLDDT = 88.5) .

  • Key Features:

    • Transmembrane helices for membrane interaction.

    • Conserved motifs linked to cell division in γ-proteobacteria .

Functional Insights

Role in Osmoadaptation:

  • C. salexigens employs Csal_0706 alongside ectoine biosynthesis and glycine betaine transporters to mitigate osmotic stress .

  • Transcriptome studies reveal upregulation of septation-related genes under high salt (25% NaCl), suggesting coordinated stress responses .

Mechanistic Studies:

  • Cell Division: Homology with E. coli FtsQ suggests involvement in divisome assembly .

  • Stress Response: Linked to cardiolipin synthesis for membrane stabilization under salinity .

Table 2: Experimental Use Cases

ApplicationDetails
Western Blotting (WB)Used as a recombinant antigen for antibody validation .
ELISAQuantifies protein expression under salt stress .
Structural BiologyAlphaFold models guide mutagenesis studies .

Key Findings:

  • Salt Stress: Csal_0706 expression correlates with survivability in 5–25% NaCl, validated via qRT-PCR .

  • Gene Regulation: Codon usage bias (C/G-rich codons) optimizes translation efficiency under stress .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type preferences, please inform us, and we will prioritize development of the specified tag.
Synonyms
yciB; Csal_0706; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768)
Target Names
Csal_0706
Target Protein Sequence
MKMLVDFLPIALFFAVYHLSDDILLATLVLIPATLAQVAFVWWRYRRVEKMQLITLALVV VMGGATVIFHDAAFIQWKPTVVNWLFAFAFLVAPLFGGKTLIERMMGKAIALPAATWRRL NLAWVAFFIALGAINVYVFKTYDEATWVNFKLFGMLGLTLLFVLGQGVYLARHMPRDTLS QNDHQKDDV
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Chromohalobacter salexigens and why is it significant for research?

Chromohalobacter salexigens is a moderately halophilic bacterium with a remarkable ability to grow across a wide range of salinity conditions. This extremophilic microorganism has been extensively used to study bacterial osmoadaptation processes and has been proposed as an alternative natural producer of compatible solutes like ectoine and hydroxyectoine . Its significance stems from its exceptional adaptability to environmental stressors, particularly high salt concentrations and temperature variations, making it an ideal model organism for studying stress response mechanisms in extremophiles.

What is the probable function of intracellular septation protein A (Csal_0706) in C. salexigens?

Based on genomic analysis and homology studies, the probable intracellular septation protein A (Csal_0706) in C. salexigens is likely involved in cell division processes, particularly in the formation of the septum during bacterial cell division. While not directly studied in the provided research, septation proteins typically play crucial roles in coordinating chromosomal segregation and cytokinesis. In halophilic bacteria like C. salexigens, these processes must be coordinated with osmoadaptation mechanisms to maintain cellular integrity under varying salt concentrations .

How does recombinant expression of Csal_0706 differ from its native expression in C. salexigens?

Recombinant expression of Csal_0706 typically involves cloning the gene into expression vectors for production in heterologous hosts like E. coli. This approach may result in differences from native expression, including: (1) altered post-translational modifications due to different cellular machinery, (2) potential misfolding when expressed outside the high-salt environment of C. salexigens, and (3) absence of native regulatory elements that control expression timing and levels. These differences must be considered when interpreting functional studies of recombinant Csal_0706, as the protein's activity may depend on specific conditions present in C. salexigens but absent in common expression hosts .

What is the genetic context of Csal_0706 within the C. salexigens genome?

The genetic context analysis of Csal_0706 would require examination of its chromosomal location and adjacent genes. While specific information about Csal_0706's genomic neighborhood is not provided in the search results, we can note that C. salexigens genome organization shows adaptation to extreme environments. Genes like ectA, ectB, and ectC are organized in clusters for ectoine synthesis, while genes encoding ectoine hydroxylases (ectD and ectE) are located at different positions in the genome (Csal_0542 and Csal_3003, respectively) . This genomic organization reflects the evolutionary adaptation of C. salexigens to osmotic stress, and Csal_0706 likely interacts with other genes involved in cell division and stress response pathways.

How might the expression of Csal_0706 be regulated under varying osmotic and temperature stress conditions?

The expression of Csal_0706 likely follows patterns similar to other stress-responsive genes in C. salexigens. Based on the regulation of other genes in this organism, Csal_0706 expression may be controlled through multiple mechanisms:

  • RpoS-dependent regulation: Similar to ectD, Csal_0706 might be regulated by the general stress sigma factor RpoS, especially during stationary phase and under temperature stress .

  • Growth phase-dependent expression: Expression may vary between exponential and stationary phases, as observed with hydroxyectoine synthesis genes .

  • Salt-dependent regulation: Given C. salexigens' halophilic nature, Csal_0706 expression may be modulated by salinity, potentially increasing at higher salt concentrations to ensure proper cell division under osmotic stress.

  • Temperature-responsive elements: Like hydroxyectoine accumulation pathways, Csal_0706 expression might be upregulated at higher temperatures (e.g., 45°C) .

A comprehensive transcriptomic analysis across different growth conditions would be necessary to fully characterize the regulation of this gene.

What potential post-translational modifications might affect Csal_0706 function in extreme environments?

In halophilic bacteria like C. salexigens, proteins often undergo specific post-translational modifications to maintain functionality in high-salt environments. For Csal_0706, relevant modifications might include:

  • Phosphorylation: Cell division proteins are often regulated by phosphorylation cascades that coordinate septation with DNA replication and segregation.

  • Methylation: DNA cytosine methylation has been shown to influence bacterial differentiation in other species . Similar epigenetic mechanisms might regulate septation protein expression or activity.

  • Salt-adaptive modifications: Increased negative surface charge through glutamate/aspartate enrichment or specific salt-bridge formations might stabilize the protein under high-salt conditions.

The investigation of these modifications would require mass spectrometry analysis of native Csal_0706 isolated from C. salexigens grown under various conditions.

How does Csal_0706 interact with the cytoskeleton and membrane during cell division in halophilic conditions?

The interaction between Csal_0706 and cytoskeletal elements during cell division likely involves:

  • Coordination with FtsZ ring formation: As a probable septation protein, Csal_0706 may interact with FtsZ and other divisome components to facilitate septum formation.

  • Membrane association: Csal_0706 likely associates with the cytoplasmic membrane at the division site, potentially through specific membrane-binding domains.

  • Osmotic stress adaptation: In high-salt environments, these interactions must accommodate the high intracellular concentrations of compatible solutes like ectoine and hydroxyectoine .

A proposed interaction model is presented in Table 1:

Table 1: Proposed Interaction Partners of Csal_0706 During Cell Division

Interaction PartnerCellular LocationPotential Function in Complex
FtsZCytoplasm/MembraneFormation of Z-ring at division site
Membrane phospholipidsCell membraneAnchoring septation machinery
DNA segregation machineryNucleoidCoordination of DNA partitioning
Cell wall synthesis enzymesPeriplasmDirection of new cell wall formation
Ectoine/HydroxyectoineCytoplasmStabilization of protein-protein interactions under osmotic stress

Experimental approaches like bacterial two-hybrid systems or co-immunoprecipitation studies could help identify these interactions.

What are the structural characteristics of Csal_0706 that enable its function in high-salt environments?

While specific structural information for Csal_0706 is not provided in the search results, halophilic proteins typically share certain adaptations:

  • Increased negative surface charge: Enrichment in acidic amino acids (Asp, Glu) on the protein surface to maintain hydration and solubility in high-salt environments.

  • Reduced hydrophobic core: Fewer large hydrophobic amino acids to prevent aggregation under salt stress.

  • Salt-bridge networks: Extensive ion-pair networks that provide structural stability in the presence of high salt concentrations.

  • Compatible solute interaction sites: Potential binding sites for ectoine or hydroxyectoine that may stabilize protein structure.

X-ray crystallography or cryo-EM studies would be necessary to confirm these structural features in Csal_0706.

What are the optimal conditions for recombinant expression and purification of Csal_0706?

For optimal recombinant expression and purification of Csal_0706, researchers should consider:

  • Expression system selection:

    • E. coli BL21(DE3) with salt-inducible promoters may mimic some aspects of the native environment

    • Alternatively, expression in moderate halophiles might preserve native folding

  • Expression conditions:

    • Induction at lower temperatures (16-20°C)

    • Inclusion of 0.5-2.5M NaCl in growth media to simulate natural conditions

    • Addition of compatible solutes like ectoine (1-5 mM) to stabilize protein folding

  • Purification strategy:

    • Maintain elevated salt concentrations throughout purification

    • Use affinity tags that function in high-salt conditions

    • Include protease inhibitors adapted for halophilic conditions

  • Refolding protocol (if expressed as inclusion bodies):

    • Gradual dialysis against buffers containing decreasing urea and increasing salt concentrations

    • Addition of ectoine or hydroxyectoine as stabilizing osmolytes

This approach draws on principles used for other halophilic proteins and should be optimized specifically for Csal_0706.

How can genetic manipulation techniques be optimized for studying Csal_0706 function in C. salexigens?

Optimizing genetic manipulation of C. salexigens to study Csal_0706 requires specialized approaches:

  • Gene knockout/mutation strategies:

    • Insertion of kanamycin resistance cassettes within the gene, similar to methods used for ectE knockout

    • Homologous recombination using suicide vectors adapted for halophiles

    • CRISPR-Cas9 systems optimized for high-salt conditions

  • Complementation assays:

    • Reintroduction of wild-type or mutant Csal_0706 variants on plasmid-based systems

    • Use of inducible promoters to control expression levels

  • Reporter gene fusions:

    • Construction of Csal_0706-GFP fusions to monitor localization

    • Promoter-reporter fusions to study transcriptional regulation

  • Growth conditions for phenotypic analysis:

    • Testing multiple salt concentrations (0.5-3.0M NaCl)

    • Varying temperatures (30-45°C) to assess temperature dependence

    • Analysis during different growth phases (exponential vs. stationary)

These approaches would enable comprehensive functional characterization of Csal_0706 in its native cellular context.

What microscopy techniques are most effective for visualizing Csal_0706 localization during cell division in high-salt conditions?

Several advanced microscopy techniques can be adapted for visualizing Csal_0706 in high-salt conditions:

  • Fluorescence microscopy approaches:

    • Fusion of Csal_0706 with fluorescent proteins engineered for halophilic conditions

    • Immunofluorescence using specific antibodies against Csal_0706

    • Time-lapse imaging to capture dynamic localization during division

  • Super-resolution techniques:

    • Structured illumination microscopy (SIM) to overcome the diffraction limit

    • Stochastic optical reconstruction microscopy (STORM) for nanometer-scale resolution

    • Stimulated emission depletion (STED) microscopy for detailed protein distribution

  • Sample preparation considerations:

    • Fixation protocols optimized for halophiles

    • Mounting media containing appropriate salt concentrations

    • Microfluidic devices for live-cell imaging under controlled salt conditions

  • Correlative approaches:

    • Electron microscopy combined with immunogold labeling

    • Correlative light and electron microscopy (CLEM) to link protein localization with cellular ultrastructure

These techniques would need to be carefully optimized to maintain cell morphology while preserving the native localization of Csal_0706.

What proteomics approaches can identify Csal_0706 interaction partners during osmotic stress response?

To identify interaction partners of Csal_0706 during osmotic stress, several complementary proteomics approaches can be employed:

  • Affinity-based methods:

    • Pull-down assays using tagged Csal_0706 as bait

    • Co-immunoprecipitation with antibodies against native Csal_0706

    • BioID proximity labeling to capture transient interactions

  • Crosslinking mass spectrometry:

    • Chemical crosslinking of protein complexes in vivo

    • MS/MS analysis of crosslinked peptides to identify interacting regions

    • Quantitative comparison across different salt concentrations

  • Interactome mapping under stress conditions:

    • Comparative analysis under normal vs. high salt/temperature stress

    • SILAC or TMT labeling for quantitative comparison

    • Analysis of stress-specific interactions

  • Functional validation:

    • Bacterial two-hybrid screening against C. salexigens genomic library

    • Construction of interaction networks including known septation proteins

    • Confirmation of key interactions through mutational analysis

Table 2: Proteomics Workflows for Studying Csal_0706 Interactions

ApproachSample PreparationAnalysis MethodExpected Outcome
AP-MSFlag-tagged Csal_0706 expression in C. salexigensLC-MS/MS of eluted proteinsCore interaction partners
XL-MSDSS/BS3 crosslinking of C. salexigens cellsMS analysis of crosslinked peptidesSpatial relationship between proteins
BioIDBirA*-Csal_0706 fusion expressionStreptavidin pulldown and MSProximal proteins including transient interactions
Comparative proteomicsC. salexigens grown at different salt concentrationsSILAC-based quantitative proteomicsSalt-dependent interactions

How should researchers interpret phenotypic changes in Csal_0706 mutants compared to wild-type C. salexigens?

Interpreting phenotypic changes in Csal_0706 mutants requires careful consideration of several factors:

  • Growth analysis framework:

    • Compare growth rates across multiple salt concentrations (0.5-3.0M NaCl)

    • Assess temperature tolerance, similar to studies of ectoine hydroxylase mutants

    • Examine growth phase transitions and stationary phase survival

  • Morphological assessment:

    • Quantitative analysis of cell size, shape, and division patterns

    • Scoring of septation defects and aberrant morphologies

    • Correlation of defects with environmental conditions

  • Contextual interpretation:

    • Consider pleiotropic effects due to stress response interconnections

    • Evaluate potential compensatory mechanisms by other septation proteins

    • Analyze gene expression changes in the mutant background

  • Environmental variables comparison:

    • Create a phenotypic matrix across multiple stress conditions

    • Identify condition-specific defects vs. general growth impairment

    • Compare with phenotypes of other cell division mutants

This framework allows for comprehensive phenotypic characterization while accounting for the complexity of stress response networks in C. salexigens.

What statistical approaches are appropriate for analyzing Csal_0706 expression data across different stress conditions?

For robust statistical analysis of Csal_0706 expression data across stress conditions:

  • Experimental design considerations:

    • Factorial design to capture interactions between salt concentration, temperature, and growth phase

    • Minimum of 3-5 biological replicates per condition

    • Include appropriate reference genes for normalization

  • Primary statistical methods:

    • Two-way or three-way ANOVA to assess main effects and interactions

    • Post-hoc tests (Tukey's HSD) for multiple comparisons

    • Linear mixed-effects models to account for batch effects

  • Advanced analytical approaches:

    • Principal component analysis to identify major sources of variation

    • Hierarchical clustering to group conditions with similar expression patterns

    • Time-series analysis for temporal expression dynamics

  • Validation and reporting:

    • Power analysis to ensure adequate sample sizes

    • Effect size reporting alongside p-values

    • Graphical representation using box plots or heat maps with appropriate error bars

These approaches ensure statistical rigor while capturing the complex relationships between multiple stress factors.

How can researchers distinguish between direct and indirect effects of Csal_0706 on cell division and stress response?

Distinguishing direct from indirect effects of Csal_0706 requires multiple complementary approaches:

  • Temporal analysis strategies:

    • High-resolution time-course experiments to establish cause-effect relationships

    • Inducible expression systems to observe immediate vs. delayed consequences

    • Single-cell analysis to capture heterogeneity in responses

  • Genetic interaction mapping:

    • Construction of double mutants with known septation or stress response genes

    • Epistasis analysis to establish pathway relationships

    • Suppressor screens to identify downstream factors

  • Biochemical verification:

    • In vitro reconstitution of key interactions

    • Activity assays with purified components

    • Structure-function analysis through targeted mutations

  • Systems biology integration:

    • Network analysis combining transcriptomics, proteomics, and metabolomics data

    • Computational modeling of septation process incorporating stress variables

    • Comparison with known regulatory networks in related species

This multi-layered approach allows researchers to build confidence in the direct mechanistic roles of Csal_0706 versus its broader influences on cellular physiology.

What are the emerging techniques that could advance our understanding of Csal_0706 function in extremophiles?

Several cutting-edge approaches hold promise for deeper insights into Csal_0706 function:

  • Single-cell technologies:

    • Single-cell RNA-seq to capture expression heterogeneity

    • Microfluidic devices for tracking individual cells under changing salt conditions

    • Single-molecule tracking of fluorescently labeled Csal_0706 in living cells

  • Structural biology advances:

    • Cryo-electron tomography to visualize Csal_0706 in the cellular context

    • AlphaFold2 predictions refined with experimental constraints

    • Time-resolved structural studies to capture conformational changes

  • Genome editing innovations:

    • CRISPR interference for tunable repression

    • Base editing for precise point mutations

    • Scarless genome editing optimized for halophiles

  • Synthetic biology approaches:

    • Minimal cell division systems reconstructed in liposomes

    • Orthogonal expression systems for controlled protein production

    • Engineering stress-responsive genetic circuits

These emerging techniques could overcome current limitations in studying extremophile proteins and provide unprecedented insights into Csal_0706 function.

How might comparative genomics across halophiles inform our understanding of Csal_0706 evolution and function?

Comparative genomic approaches can provide valuable evolutionary context for Csal_0706:

  • Phylogenetic analysis framework:

    • Comparison across diverse halophiles and non-halophiles

    • Identification of conserved domains vs. halophile-specific adaptations

    • Detection of selection signatures in specific lineages

  • Genomic context examination:

    • Analysis of gene neighborhood conservation

    • Identification of co-evolved gene clusters

    • Assessment of horizontal gene transfer events

  • Structure-function relationship analysis:

    • Correlation between amino acid composition and habitat salinity

    • Mapping of conserved vs. variable regions to functional domains

    • Identification of halophile-specific structural motifs

  • Functional prediction refinement:

    • Integration of genomic and metagenomic data from extreme environments

    • Co-expression network analysis across multiple species

    • Machine learning approaches to predict function from sequence features

These comparative approaches could reveal how Csal_0706 evolved to function in extreme environments and identify conserved mechanisms across diverse halophiles.

What potential biotechnological applications might emerge from understanding Csal_0706 function in C. salexigens?

Understanding Csal_0706 could enable several innovative biotechnological applications:

  • Protein engineering opportunities:

    • Development of salt-stable enzymes for industrial processes

    • Creation of osmotically resistant cell division systems

    • Engineering of protein scaffolds stable in extreme conditions

  • Synthetic biology applications:

    • Design of salt-inducible genetic circuits for controlled gene expression

    • Engineering of microorganisms with enhanced growth in high-salt environments

    • Development of biosensors for environmental monitoring

  • Biomaterial development:

    • Creation of self-assembling protein structures stable in extreme conditions

    • Development of stress-resistant biofilms for environmental applications

    • Engineering of cell-free division systems for nanotechnology

  • Therapeutic potential:

    • Discovery of new antimicrobial targets based on unique septation mechanisms

    • Development of inhibitors specific to bacterial cell division proteins

    • Exploration of ectoine-protein interactions for protein stabilization

These applications would build upon fundamental knowledge of Csal_0706 while addressing practical challenges in biotechnology and medicine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.