Recombinant Chromohalobacter salexigens Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Prolipoprotein Diacylglyceryl Transferase (Lgt)

Prolipoprotein diacylglyceryl transferase (Lgt) is a membrane-bound enzyme critical for bacterial lipoprotein biosynthesis. In Chromohalobacter salexigens, Lgt catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of a conserved cysteine residue in prolipoproteins, forming thioether-linked diacylglyceryl-prolipoproteins . This modification is essential for lipoprotein maturation and membrane anchoring, enabling bacteria like C. salexigens to thrive in high-salinity environments .

Table 1: Key Functional Residues in C. salexigens Lgt

ResidueRole in CatalysisImpact of Alanine Substitution
Y26Substrate bindingComplete loss of activity
N146Structural stabilityNo growth in depletion strain
G154Active-site geometryLethal mutation
R143/E151Electrostatic interactionsReduced activity

Recombinant Expression and Purification

Recombinant C. salexigens Lgt has been expressed in heterologous systems like E. coli using plasmid vectors (e.g., pBAD18s-Cm) under arabinose-inducible promoters . Key steps include:

  1. Cloning: lgt gene amplified via PCR and ligated into pUC18 or pBAD18s vectors .

  2. Tagging: Addition of c-myc tags for protein tracking .

  3. Solubilization: Membrane extraction using detergents (e.g., Triton X-100) .

Table 2: Expression Conditions for Recombinant Lgt

ParameterOptimal Condition
InducerL-arabinose (0.2% w/v)
Temperature37°C
Salt ToleranceUp to 3.0 M NaCl

Biochemical Properties

  • Enzyme Activity: Requires phosphatidylglycerol as a lipid donor and is inhibited by divalent cations (Zn²⁺, Cu²⁺) .

  • Thermostability: Retains 60% activity after 8 hours at 50°C in 3.0 M NaCl .

  • pH Optimum: Stable at pH 6.0–8.5, with peak activity at pH 8.5 .

Applications and Research Implications

  1. Antibacterial Targets: Lgt is essential for bacterial survival, making it a candidate for novel antibiotics .

  2. Biotechnological Uses: Halophilic Lgt variants are valuable for industrial processes requiring salt-tolerant enzymes .

  3. Stress Adaptation: Studies on C. salexigens Lgt provide insights into osmoadaptation mechanisms in extremophiles .

Challenges and Future Directions

  • Expression Yields: Low yields (0.75–18 mg/L culture) necessitate optimization of codon usage and promoter systems .

  • Structural Studies: No high-resolution crystal structure of C. salexigens Lgt exists; homology modeling based on E. coli Lgt is currently used .

  • Substrate Specificity: Further research is needed to elucidate lipid-binding preferences in high-salinity conditions .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference during order placement. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize the development of that tag type.
Synonyms
lgt; Csal_2573; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768)
Target Names
lgt
Target Protein Sequence
MLTYPDIDPVAIALGPFKVHWYGLMYVVGFVGAWWLGRRRADRLGVQPDAIGDLLFYGAL GVVLGGRVGYALFYGFERLAADPLWIFQVWDGGMSFHGGLIGVLIAAWLFARKHRLAFFQ LTDFVAPLVPLGLGAGRIGNFINHELPGRVTDVPWALVYPGLGPEGRHPSPLYEFALEGV VMFVVLWWVSSRPRRRGMISGLFLLLYAVFRFSVEFVRRPDPQLGFIAFDWLTMGQLLTV PMALAGIALCVWSRRQPVDDARMQAAT
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, the first step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of Lgt in bacterial cell physiology?

Lgt (Prolipoprotein diacylglyceryl transferase) catalyzes the first irreversible step in the sequential pathway of bacterial lipoprotein modification. Specifically, it transfers a diacylglyceryl moiety from phosphatidylglycerol to the thiol group of the conserved cysteine in prolipoproteins via a thioether bond . This modification is essential for bacterial viability as it initiates the process of lipoprotein maturation, which is crucial for cell envelope integrity. In Gram-negative bacteria like E. coli, Lgt depletion leads to severe growth and morphological defects, permeabilization of the outer membrane, and increased sensitivity to serum killing and antibiotics .

How is Lgt structurally organized within the bacterial membrane?

Lgt is embedded in the membrane by seven transmembrane segments, with its N terminus facing the periplasm and its C terminus facing the cytoplasm . This transmembrane organization positions the enzyme to access both the phosphatidylglycerol substrate within the membrane and the prolipoprotein substrates that need modification. The majority of the essential residues of Lgt are located within the membrane regions, and the Lgt signature motif faces the periplasm . This specific membrane topology is crucial for the enzyme's ability to perform its catalytic function at the interface between the membrane and periplasmic space.

What are the conserved domains and essential residues in bacterial Lgt proteins?

Highly conserved amino acids have been identified in Lgt proteins from both Gram-negative and Gram-positive bacteria. Studies with E. coli Lgt revealed that:

  • Residues Y26, N146, and G154 are absolutely required for Lgt function

  • Residues R143, E151, R239, and E243 are important for optimal activity

  • Lgt enzymes are characterized by a signature motif in which four residues are invariant

Additional residues found to be essential for function include H103, while mutations in residues G98, G104, and E151 delay growth but don't completely abolish function . Conservation of these key residues across bacterial species, including C. salexigens, suggests their critical role in substrate recognition, catalysis, or maintaining proper protein conformation.

How can researchers measure the enzymatic activity of C. salexigens Lgt?

The enzymatic activity of Lgt can be measured by detecting the release of glycerol phosphate, which is a by-product of the Lgt-catalyzed transfer reaction. The assay methodology includes:

  • Using a peptide substrate derived from a lipoprotein (such as Pal-IAAC, where C is the conserved cysteine)

  • Providing phosphatidylglycerol as the lipid substrate

  • Monitoring release of glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) via a coupled luciferase reaction

Additionally, successful modification can be confirmed by:

  • Mass spectrometry to detect the addition of 552 Da to the peptide substrate, corresponding to the diacylglyceryl moiety

  • SDS-PAGE analysis to observe a slower-migrating species of the modified peptide

What genetic approaches can be used to study Lgt function in C. salexigens?

Several genetic approaches can be employed to study Lgt function:

  • Creation of inducible deletion strains where lgt expression is under the control of an inducible promoter (as demonstrated with arabinose-inducible promoters in E. coli)

  • Complementation assays using a wild-type lgt gene to restore function in lgt-depleted strains

  • Site-directed mutagenesis of conserved residues to identify those critical for function

  • CRISPRi technology to decrease gene expression in a controlled manner to assess the effects of reduced Lgt levels

  • Analysis of genetic interactions through creation of double mutants (e.g., combining lgt mutation with deletion of other genes involved in cell envelope biogenesis)

These approaches can reveal the essentiality of Lgt, identify important functional residues, and elucidate its role in cellular processes in halophilic bacteria like C. salexigens.

What approaches can be used to study Lgt inhibition in C. salexigens?

Multiple complementary approaches can be employed to study Lgt inhibition:

  • Biochemical assays measuring inhibition of glycerol phosphate release in the standard activity assay

  • Testing compounds for their ability to inhibit the addition of diacylglyceryl to peptide substrates via mass spectrometry

  • SDS-PAGE analysis to detect changes in lipoprotein modification patterns

  • Western blot analysis to monitor accumulation of unmodified prolipoprotein substrates

  • Microscopic examination of cell morphology to observe phenotypes similar to genetic Lgt depletion

  • Growth inhibition assays under various salt concentrations to determine if inhibition is affected by osmotic conditions

  • Assessment of membrane integrity using permeability assays

These methods provide a comprehensive framework for identifying and characterizing potential Lgt inhibitors in C. salexigens.

What can lateral gene transfer studies tell us about Lgt evolution in halophiles?

Studies on lateral gene transfer (LGT) in halophilic environments provide insights into how genes like lgt might have evolved in C. salexigens:

  • Research on halophilic archaea (Halobacteria) showed that many LGT events originated from non-halophiles, suggesting that adaptation to salt might occur after gene transfer

  • This contrasts with thermophilic archaea, where most LGT events originated from other thermophiles

  • For example, of the LGT events with BLAST bit scores greater than 500 identified in Halobacteria, approximately 76% were from species with no known halophilic tendencies

These findings suggest that C. salexigens' lgt gene might have been acquired from non-halophilic bacteria and subsequently adapted to function in high-salt environments, potentially retaining some characteristics of the donor organism while evolving adaptations to the halophilic lifestyle.

How does C. salexigens genome adaptation influence Lgt function?

C. salexigens has undergone genome-wide adaptations to its halophilic lifestyle that likely influence Lgt function:

  • Genome analysis reveals adaptations in GC content, dinucleotide composition, and amino acid preferences that distinguish halophilic from non-halophilic organisms

  • The bacterium has adapted its central metabolism to support the biosynthesis of compatible solutes like ectoine and hydroxyectoine that protect against osmotic stress

  • Metabolic network reconstruction of C. salexigens shows extensive adaptations for growth under high salinity, including shifts in enzyme distributions and metabolic pathways

These genomic and metabolic adaptations create a distinct cellular environment in which Lgt must function, potentially influencing its expression, regulation, substrate availability, and interaction with other cellular components.

What is the relationship between Lgt function and osmoadaptation in C. salexigens?

While direct evidence linking Lgt function to osmoadaptation in C. salexigens is limited, several potential relationships exist:

  • Lipoproteins modified by Lgt are important components of the bacterial cell envelope, which serves as the primary barrier against osmotic stress

  • C. salexigens accumulates compatible solutes like ectoine, hydroxyectoine, and trehalose in response to osmotic stress , and the transport or biosynthesis systems for these compounds might involve lipoproteins that require Lgt-mediated modification

  • Disruption of Lgt function could compromise cell envelope integrity, potentially affecting the cell's ability to maintain proper turgor pressure under osmotic challenge

  • Proper lipoprotein modification may be critical for the functioning of transporters, sensors, and enzymes involved in the osmoadaptive response

Research examining the lipoprotein composition of C. salexigens under different salinity conditions and analyzing how Lgt activity correlates with osmoadaptive responses could further elucidate these relationships.

How does temperature influence Lgt function in C. salexigens?

The relationship between temperature and Lgt function in C. salexigens appears complex:

  • C. salexigens responds to heat stress by producing compatible solutes, particularly hydroxyectoine

  • Desiccation tolerance in C. salexigens is slightly improved when cells are grown at high temperature

  • C. salexigens engineered strains showed altered compatible solute profiles at higher temperatures, but the specific impact on Lgt has not been directly studied

Temperature might affect Lgt function through:

  • Changes in membrane fluidity that could alter substrate accessibility

  • Temperature-dependent regulation of lgt expression

  • Effects on protein folding and stability in the membrane environment

  • Alterations in substrate availability due to temperature-induced changes in phospholipid composition

What are the implications of Lgt inhibition for developing novel antimicrobials targeting halophilic bacteria?

Research on Lgt inhibition reveals promising directions for antimicrobial development:

  • Unlike inhibition of other steps in lipoprotein biosynthesis, deletion of the major outer membrane lipoprotein Lpp is not sufficient to rescue growth after Lgt depletion

  • This suggests that resistance to Lgt inhibitors might not readily develop through the common mechanism of lipoprotein modification pathway bypass

  • Lgt inhibitors have been identified that potently inhibit Lgt biochemical activity in vitro and are bactericidal against wild-type bacterial strains

For C. salexigens specifically, Lgt inhibitors might have unique effects due to:

  • The bacterium's distinctive adaptation to high-salt environments

  • Potential differences in lipoprotein composition compared to non-halophilic bacteria

  • The role of properly modified lipoproteins in maintaining cell envelope integrity under osmotic stress

How do Lgt enzymes compare between Gram-positive and Gram-negative bacteria?

Despite divergent evolutionary paths, Lgt enzymes from Gram-positive and Gram-negative bacteria share key structural and functional characteristics:

CharacteristicGram-negative (E. coli)Gram-positive (S. aureus)Similarity
Sequence lengthLonger protein12 amino acids shorterModerate
Sequence identity-24% with E. coli LgtLow
Sequence similarity-47% with E. coli LgtModerate
Hydropathic profileSimilar patternSimilar patternHigh
Predicted pIBasic (>10)Basic (10.4)High
FunctionEssentialEssentialHigh
Substrate specificityRecognizes lipobox motifRecognizes lipobox motifHigh

This conservation of functional properties despite sequence divergence suggests that the essential catalytic residues and structural elements are maintained across bacterial taxonomic boundaries , which has implications for both the evolutionary history of these enzymes and the potential development of broad-spectrum Lgt inhibitors.

How has C. salexigens Lgt evolved compared to related halophilic species?

C. salexigens belongs to the Halomonadaceae family, which includes several halophilic species. Evolutionary analysis reveals:

  • C. salexigens was originally classified as Halomonas elongata DSM 3043 before being recognized as a separate species based on phenotypic differences and phylogenetic distance

  • Both C. salexigens and H. elongata show similar temperature ranges (15-45°C) and optimal salinity (8.7-11.6% NaCl) for growth, but C. salexigens appears to have more stringent salt requirements

  • The evolutionary pattern of genes involved in adaptation to extreme environments suggests that some halophilic adaptations may have arisen from duplication of ancestral genes followed by directional divergence

This evolutionary history suggests that C. salexigens Lgt likely shares core functionality with related halophilic species but may have unique adaptations reflecting its particular environmental niche and more stringent salt requirements.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.