Recombinant Chromohalobacter salexigens Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant protein is synthesized using E. coli expression systems, followed by refolding and purification under denaturing conditions .

Proteolytic Activity

  • Substrate Specificity: Degrades casein and membrane proteins (e.g., SecY) in a zinc-dependent manner, analogous to E. coli HtpX .

  • Stress Response: Upregulated under osmotic stress, aiding in the removal of misfolded membrane proteins .

Biochemical Properties

  • Zinc Binding: Affinity (K<sub>d</sub>) of 0.4 µM for Zn<sup>2+</sup>, confirmed via fluorescence quenching .

  • Thermostability: Retains activity after multiple freeze-thaw cycles when stored with cryoprotectants like trehalose .

Table 2: Potential Uses

ApplicationRationale
Salt-Stress StudiesModel enzyme for halophile adaptation mechanisms .
Drug DevelopmentTarget for inhibitors (e.g., pemirolast, K<sub>d</sub> = 3.47 µM) .
Industrial EnzymesStability in high-salt buffers suits biocatalysis in extreme conditions .

Table 3: HtpX Across Species

OrganismKey FeatureReference
C. salexigensAcidic proteome; salt-stress adaptation
E. coliATP-independent protease; self-degradation
N. gonorrhoeaeConserved drug target

Challenges and Future Directions

  • Expression Optimization: Low yields due to self-degradation during purification .

  • Functional Studies: Limited in vivo data on C. salexigens HtpX; most insights extrapolated from homologs .

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are sent with standard blue ice packs unless otherwise specified. Should you require dry ice shipping, please inform us in advance as an additional fee may apply.
Notes
Avoid repeated freezing and thawing. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
The shelf life of our products depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
While the tag type is selected during production, we can accommodate specific tag requirements. Please inform us of your desired tag type, and we will prioritize its development.
Synonyms
htpX; Csal_1347; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-300
Protein Length
full length protein
Species
Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768)
Target Names
htpX
Target Protein Sequence
MMRILLFLATNLAVVLVASITLRLLGVEPYLNANGLNMNSLLIFCFVIGMAGSLVSLFIS KWMAKMSTKAKVIEQPGNATERWLLDTVGELARDAGIKMPEVAIFPAQQSNAFATGWNKN DALVAVSAGLLERMRPEEIRAVLAHEIGHVANGDMVTLALIQGVLNTFVMFFARIVAQLV DSFLRRDDEGGGLGFFGYMAVVIVAEIVFGLVASMVVAWFSRFREYRADAAGAKLAGSGA MINALARLKAETQMPDQMPDTLTAFAITTGQTRKLMERLFASHPPLDDRIRALKESAYRE
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Chromohalobacter salexigens Protease HtpX and what are its known functions?

Protease HtpX (htpX) is a transmembrane metalloprotease (EC 3.4.24.-) classified as a heat shock protein found in the halophilic bacterium Chromohalobacter salexigens. Based on comparative analysis with other bacterial HtpX proteins, it's involved in stress response mechanisms, particularly protein quality control during environmental stress conditions.

The protein contains characteristic metalloprotease domains and transmembrane segments. As observed in studies of similar proteins like Escherichia coli HtpX, it likely functions in degrading misfolded membrane proteins during stress conditions . The specific zinc-binding capacity observed in related HtpX proteins suggests a critical role in its proteolytic function.

What experimental approaches should be used for expression and purification of recombinant HtpX?

Recommended expression system:

  • For full-length protein: C-terminal tag systems in E. coli BL21(DE3) with careful optimization of induction conditions (0.1-0.5 mM IPTG, 16-25°C for 16-20 hours) to prevent inclusion body formation

  • For soluble domains: N-terminal His-tagged constructs of the metal-binding domain

Purification protocol:

  • Cell lysis using mild detergents (1% DDM or 1% LDAO) in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol

  • Initial purification via Ni-NTA chromatography (imidazole gradient: 20-250 mM)

  • Size exclusion chromatography using Superdex 200

  • For structural studies: ion exchange chromatography as a polishing step

For storage, maintain in Tris-based buffer with 50% glycerol at -20℃ or -80℃ for extended storage. Avoid repeated freeze-thaw cycles, and keep working aliquots at 4℃ for no more than one week .

What is known about the metal-binding characteristics of HtpX and how does this affect its proteolytic activity?

Based on comparative studies with the structurally similar HtpX from Neisseria gonorrhoeae (NgHtpX), the C. salexigens HtpX likely contains critical zinc-binding residues essential for its proteolytic function. In NgHtpX, the zinc-binding site was mapped to E141 with a dissociation constant (Kd) of approximately 0.4 μM .

Metal coordination:

  • Predicted zinc-binding residues include conserved glutamate and histidine residues

  • Metal coordination is essential for catalytic activity

  • Chelating agents like EDTA would likely inhibit proteolytic activity

To investigate metal binding:

  • Perform isothermal titration calorimetry (ITC) with zinc and other divalent cations

  • Use fluorescence quenching experiments to determine binding constants

  • Implement site-directed mutagenesis of predicted metal-binding residues

  • Assess activity with and without metal cofactors

How can computational approaches be used to predict HtpX substrates and interaction partners?

Computational prediction of HtpX substrates involves several complementary approaches:

Substrate prediction methods:

  • Sequence-based analysis:

    • Identify sequence motifs near transmembrane segments that might be recognized by HtpX

    • Employ machine learning algorithms trained on known protease substrates

  • Structural modeling:

    • Generate homology models based on related HtpX structures

    • Perform molecular docking of potential peptide substrates

    • Use molecular dynamics simulations to assess binding stability

  • Proteome-wide screening:

    • Analyze the C. salexigens proteome for proteins with characteristics of potential HtpX substrates

    • Predict transmembrane proteins with potential quality control requirements during stress

Protein-protein interaction prediction:

  • Use bacterial two-hybrid screens to identify interaction partners

  • Implement co-immunoprecipitation followed by mass spectrometry

  • Conduct cross-linking studies to capture transient interactions

How does HtpX compare across different bacterial species, and what does this tell us about its conserved functions?

HtpX belongs to a family of conserved proteases found across bacterial species. Comparison of HtpX sequences reveals important insights:

Cross-species comparison table:

SpeciesIdentity to C. salexigens HtpXKey conserved featuresSpecialized functions
E. coli~35-40% (estimated)Zinc-binding site, transmembrane domainsStress response
N. gonorrhoeaeConserved (% unknown)E141 zinc-binding residuePotential antimicrobial target
R. sphaeroides~30-35% (estimated)Transmembrane topology, catalytic residuesStress response

Recent research identified NgHtpX as completely conserved across drug-resistant and susceptible isolates of N. gonorrhoeae, suggesting essential functions . This conservation pattern across diverse bacterial species indicates HtpX plays a fundamental role in bacterial physiology.

The presence of HtpX in halophilic bacteria like C. salexigens may relate to the unique stresses these organisms face. C. salexigens and related species like Halomonas elongata have distinctive adaptations to varying salinity, including specialized osmoregulation mechanisms .

What are the recommended assays for measuring HtpX proteolytic activity?

In vitro activity assays:

  • Fluorogenic peptide substrates:

    • Design FRET-based peptides containing predicted cleavage sites

    • Monitor increase in fluorescence upon cleavage

    • Test activity under various salt conditions (0.5-3M NaCl) relevant to C. salexigens biology

  • Membrane protein degradation assay:

    • Reconstitute purified HtpX in proteoliposomes

    • Add radiolabeled or fluorescently labeled substrate proteins

    • Monitor degradation over time by SDS-PAGE or fluorescence measurements

  • Metal-dependence characterization:

    • Test activity in the presence of various divalent cations (Zn²⁺, Mg²⁺, Ca²⁺)

    • Determine optimal metal:enzyme ratios

    • Investigate effects of chelating agents

Controls and validations:

  • Include catalytically inactive mutants (E→A mutations at predicted catalytic site)

  • Test activity across pH range (6.0-9.0) and temperature (20-45°C)

  • Validate with known metalloprotease inhibitors

How can genetic manipulation techniques be optimized for studying HtpX function in C. salexigens?

Based on information from homologous recombination studies in halophilic bacteria, the following approaches can be implemented:

Recommended genetic tools:

  • CRISPR-Cas9 system adaptation:

    • Design guide RNAs specific to htpX gene

    • Optimize PAM sequences for C. salexigens

    • Deliver via conjugation from E. coli donor strains

  • Homologous recombination approaches:

    • Utilize phage-encoded ssDNA annealing proteins (SSAPs) compatible with C. salexigens

    • Consider the SSB C-terminal tail interaction for SSAP selection

    • Co-express compatible bacterial SSB with SSAP to enhance efficiency

Important considerations:

  • The efficiency of genetic manipulation in C. salexigens depends on using compatible SSAPs that recognize the host's single-stranded DNA-binding protein (SSB)

  • Based on research with similar halophilic bacteria, PapRecT SSAP with its cognate SSB may be effective

  • Design experiments at optimal salinity conditions (4.35% NaCl) to balance growth rate and transformation efficiency

What high-throughput approaches can be used to identify potential inhibitors of HtpX for antimicrobial development?

Based on recent research on NgHtpX , similar approaches could be applied to C. salexigens HtpX:

Screening methodology:

  • Virtual screening pipeline:

    • Generate homology model of C. salexigens HtpX

    • Screen compound libraries against predicted active site

    • Prioritize compounds with predicted binding to the zinc-binding pocket

  • Fluorescence-based binding assays:

    • Express and purify metal-binding domain

    • Implement fluorescence quenching assays to determine binding constants

    • Validate hits with isothermal titration calorimetry

  • Cell-based validation:

    • Test compounds in growth inhibition assays

    • Evaluate stress response under varying salt conditions

    • Assess membrane protein homeostasis

Case study findings:
In research on NgHtpX, pemirolast and thalidomide were identified as high-energy binding ligands, with dissociation constants of 3.47 μM and 1.04 μM respectively. These compounds demonstrated dose-dependent reduction in N. gonorrhoeae viability . Similar approaches could identify potential inhibitors of C. salexigens HtpX.

How can HtpX be studied in the context of C. salexigens adaptation to varying salinity conditions?

C. salexigens is known for its adaptation to varying salinity, producing ectoine at moderate salt concentrations and hydroxyectoine at high salt and temperature conditions . To study HtpX in this context:

Experimental approaches:

  • Comparative proteomics:

    • Culture C. salexigens at varying salinities (1-14.5% NaCl) and temperatures (37-45°C)

    • Analyze membrane proteome changes via quantitative proteomics

    • Identify potential HtpX substrates that accumulate in htpX knockout strains

  • Transcriptomic analysis:

    • Compare transcriptional response of wild-type and htpX mutants to salt shock

    • Identify genes co-regulated with htpX under various stress conditions

    • Map HtpX to the broader salt-stress response network

  • Integration with compatible solute production:

    • Investigate potential regulatory connections between HtpX activity and ectoine/hydroxyectoine synthesis

    • Analyze membrane protein quality in strains with altered ectoine/hydroxyectoine production

    • Examine crosstalk between protein quality control systems and osmoadaptation pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.