Recombinant Chromohalobacter salexigens UPF0761 membrane protein Csal_1895 (Csal_1895)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Chromohalobacter salexigens UPF0761 Membrane Protein Csal_1895 (Csal_1895)

Recombinant Chromohalobacter salexigens UPF0761 membrane protein Csal_1895 (Csal_1895) is a full-length, His-tagged protein expressed in E. coli for research applications. This 410-amino acid protein (UniProt ID: Q1QWB1) is derived from C. salexigens, a halophilic γ-proteobacterium renowned for its extreme halotolerance and role as a model organism for osmoadaptation studies . While its precise biological function remains under investigation, Csal_1895 is classified as a UPF0761 family membrane protein, suggesting potential roles in stress response or ion transport .

Primary Structure

The amino acid sequence of Csal_1895 (MRRPQLLDRRWLTIILRSLRELIQRFDAHDGLKTASALTYTTLFAVVPFMTVLYAMLSAI PSFQGISEQLQALIFSQFVPATGSALVEHLRDFSRQARSLTLIGLMFLLVTAVMMMVTVE RAFNNIWHVSRSRRGVSSFLLYWAVLTLGPLLLGSGFLLSSYLASLTLVRGAAEVLGGPV AFLRLLPLTLSFTAFVFIYMAVPNCRVRFRHAVAGAGLAALALELAKGAFSLYVTYFPSY QVIYGTFAAVPLFLVWVFLSWAIVLVGAELAAWLGERRRAEWRYWAPFWQALGVVSHLYD AHRRGQAVYDRELAMRLGARYSDVMAPLQTLGVAVQLDNDRWMLGRDLGALSLWDFQRAM PWAVPLGESSPAPEMQAIHAALQEAERHRQQVLTQPMEHLLAEGARNDSP) includes conserved domains typical of membrane-associated proteins, such as hydrophobic regions indicative of transmembrane helices .

Production and Purification

ParameterSpecification
Expression HostE. coli
TagN-terminal His-tag
LengthFull-length (1–410 aa)
Purity>90% (SDS-PAGE)
FormLyophilized powder in Tris/PBS buffer (6% trehalose, pH 8.0)
Storage-20°C/-80°C (aliquoted); working aliquots stable at 4°C for ≤1 week
Reconstitution0.1–1.0 mg/mL in sterile water; 5–50% glycerol recommended for long-term storage

Functional Insights from Related Research

While direct functional data on Csal_1895 is limited, studies on C. salexigens provide context for its potential roles:

  • Osmotic Stress Adaptation: C. salexigens employs ectoine and hydroxyectoine biosynthesis under osmotic stress, with membrane proteins modulating ion gradients and respiratory chain components . Csal_1895 may contribute to these pathways, as transcriptomic analyses reveal salinity-dependent regulation of membrane protein genes .

  • Thermal Stress Response: High temperatures repress ectoine degradation genes while inducing membrane protein-related transcripts, suggesting Csal_1895 could participate in thermoadaptation .

  • Iron Homeostasis: Membrane proteins in C. salexigens influence iron uptake and siderophore production, which indirectly affects ectoine synthesis .

Experimental Use Cases

  • Membrane Protein Studies: As a recombinant product, Csal_1895 enables structural analyses (e.g., cryo-EM, NMR) and functional assays to probe its role in haloadaptation .

  • Biotechnological Engineering: May serve as a scaffold for developing salt-tolerant enzymes or biosensors, leveraging C. salexigens' extremophile properties .

Stability and Handling

ChallengeSolution
AggregationUse trehalose-containing buffers during reconstitution
ProteolysisAvoid repeated freeze-thaw cycles; store aliquots at -80°C
Activity LossOptimize glycerol concentration (20–50%) for long-term storage

Future Research Directions

  1. Functional Characterization: Elucidate Csal_1895's role in ion transport or osmolyte synthesis using knockout strains .

  2. Structural Resolution: Apply advanced techniques like single-particle cryo-EM or X-ray crystallography to determine its 3D architecture .

  3. Biotechnological Optimization: Engineer E. coli expression systems to enhance yield and stability for industrial applications .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it during your order placement. We will prepare according to your request.
Lead Time
Delivery times may vary depending on the purchase method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Csal_1895; UPF0761 membrane protein Csal_1895
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-410
Protein Length
full length protein
Species
Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768)
Target Names
Csal_1895
Target Protein Sequence
MRRPQLLDRRWLTIILRSLRELIQRFDAHDGLKTASALTYTTLFAVVPFMTVLYAMLSAI PSFQGISEQLQALIFSQFVPATGSALVEHLRDFSRQARSLTLIGLMFLLVTAVMMMVTVE RAFNNIWHVSRSRRGVSSFLLYWAVLTLGPLLLGSGFLLSSYLASLTLVRGAAEVLGGPV AFLRLLPLTLSFTAFVFIYMAVPNCRVRFRHAVAGAGLAALALELAKGAFSLYVTYFPSY QVIYGTFAAVPLFLVWVFLSWAIVLVGAELAAWLGERRRAEWRYWAPFWQALGVVSHLYD AHRRGQAVYDRELAMRLGARYSDVMAPLQTLGVAVQLDNDRWMLGRDLGALSLWDFQRAM PWAVPLGESSPAPEMQAIHAALQEAERHRQQVLTQPMEHLLAEGARNDSP
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of UPF0761 membrane protein Csal_1895?

UPF0761 membrane protein Csal_1895 from Chromohalobacter salexigens is a full-length protein consisting of 410 amino acids with transmembrane domains characteristic of integral membrane proteins . The protein's structural architecture includes specific membrane-spanning regions that facilitate its insertion into cellular membranes. Understanding its primary sequence is essential for downstream applications including recombinant expression, purification strategies, and structural studies.

What expression systems are most effective for producing recombinant Csal_1895?

Multiple expression systems can be employed for recombinant production of Csal_1895, each with distinct advantages. E. coli and yeast expression systems offer the highest yields and shorter turnaround times, making them ideal for initial characterization studies and when larger quantities are required . For studies requiring post-translational modifications necessary for proper folding or activity maintenance, insect cell expression using baculovirus vectors or mammalian cell expression systems are recommended . When selecting an expression system, researchers should consider:

  • Required protein yield

  • Need for post-translational modifications

  • Experimental timeline constraints

  • Downstream application requirements

  • Available laboratory resources

How can researchers optimize protein tag selection for Csal_1895 purification?

The selection of protein tags significantly impacts purification efficiency and downstream applications. His-tagged versions of Csal_1895 have been successfully expressed and purified , enabling metal affinity chromatography-based isolation. When optimizing tag selection, consider:

  • Tag position (N-terminal vs. C-terminal) based on predicted membrane topology

  • Tag size impact on protein folding and function

  • Cleavage site inclusion for tag removal if necessary for structural or functional studies

  • Compatibility with detergent solubilization methods required for membrane proteins

  • Potential interference with functional domains or interaction sites

What are the critical factors for successful membrane extraction of Csal_1895?

Efficient extraction of Csal_1895 from membrane fractions requires careful optimization of several parameters:

  • Detergent selection: Screen multiple detergents (e.g., DDM, LDAO, Triton X-100) at varying concentrations. The optimal detergent must solubilize the protein while maintaining its native conformation.

  • Buffer composition: Implement a systematic evaluation of pH ranges (typically 6.5-8.5), salt concentrations (100-500 mM), and stabilizing additives (glycerol, specific lipids).

  • Extraction time and temperature: Test extraction times (1-24 hours) at different temperatures (4°C vs. room temperature).

  • Mechanical disruption: Compare gentle rotation versus sonication or microfluidization for membrane disruption efficiency.

Methodology should include analytical techniques such as Western blotting and activity assays to monitor extraction efficiency across conditions.

How should researchers approach detergent screening for Csal_1895 solubilization?

A systematic detergent screening approach should be implemented:

Detergent ClassExamplesStarting ConcentrationAdvantagesLimitations
MaltosidesDDM, UDM1-2× CMCMild, widely usedLarger micelles
GlucosidesOG, NG1.5-3× CMCSmaller micellesMore denaturing
ZwitterionicLDAO, FC-122-5× CMCEffective solubilizationPotential denaturation
NonionicTriton X-1001-2× CMCGentle extractionUV interference
Cholate derivativesCholate, Deoxycholate1-2× CMCMimics lipid environmentpH dependent
Styrene Maleic Acid (SMA)SMA copolymers2.5% w/vNative lipid retentionIncompatible with divalent cations

Protocol should include:

  • Small-scale extractions (1-5 mL)

  • Analysis by SDS-PAGE and Western blotting

  • Size-exclusion chromatography to evaluate oligomeric state

  • Activity or binding assays to confirm functional integrity

What chromatography strategies yield the highest purity for Csal_1895?

A multi-step chromatography approach typically yields the highest purity:

  • Primary capture: Immobilized metal affinity chromatography (IMAC) utilizing the His-tag . Optimize imidazole concentration in washing steps (20-50 mM) to remove weakly bound contaminants while retaining target protein.

  • Intermediate purification: Ion exchange chromatography based on Csal_1895's predicted isoelectric point. Use salt gradient elution (50-500 mM NaCl) with shallow gradients to maximize separation.

  • Polishing step: Size exclusion chromatography to separate monomeric protein from aggregates and to exchange into final buffer. Select column matrix based on expected molecular weight of protein-detergent complex.

  • Quality control metrics:

    • SDS-PAGE analysis (>95% purity)

    • Western blot confirmation

    • Dynamic light scattering to assess homogeneity

    • Mass spectrometry for identity confirmation

What are the most effective methods for determining membrane topology of Csal_1895?

Determining membrane topology requires complementary experimental approaches:

  • Computational prediction: Utilize algorithms specifically designed for membrane proteins (TMHMM, Phobius, TOPCONS) to generate initial topology models.

  • Cysteine scanning mutagenesis: Systematically introduce cysteine residues at predicted loop regions followed by accessibility labeling with membrane-impermeable reagents.

  • Epitope insertion: Insert epitope tags (e.g., FLAG, myc) at predicted loops and termini, followed by immunofluorescence in permeabilized vs. non-permeabilized cells.

  • Protease protection assays: Express in membrane vesicles with defined orientation, then perform limited proteolysis with identification of protected fragments by mass spectrometry.

  • Fluorescence-based approaches: Utilize GFP fusion constructs with subsequent pH-sensitivity analysis or fluorescence quenching experiments.

Data integration across multiple methods provides the most reliable topology model, particularly for complex multi-spanning membrane proteins like Csal_1895.

How can researchers develop soluble analogues of Csal_1895 for structural studies?

Recent advances in computational design enable the creation of soluble analogues of membrane proteins like Csal_1895:

  • Deep learning pipeline implementation: Utilize robust deep learning approaches that can design complex folds and soluble analogues while maintaining core structural features .

  • Topology preservation: Ensure the unique membrane topology features are recapitulated in the soluble design by maintaining critical intramolecular contacts and fold characteristics .

  • Stability optimization: Conduct in silico stability analysis and iterative design improvements to achieve high thermal stability in solution .

  • Experimental validation workflow:

    • Expression screening in E. coli

    • Purification without detergents

    • Circular dichroism to assess secondary structure

    • Thermal denaturation assays to evaluate stability

    • Crystallization trials or NMR studies for structural validation

  • Functional motif integration: Incorporate native structural motifs from the membrane protein to create functional soluble analogues, potentially enabling new approaches in structural biology and drug discovery .

What crystallization strategies are most promising for membrane proteins like Csal_1895?

Crystallization of membrane proteins requires specialized approaches:

  • Pre-crystallization screening:

    • Thermal stability assays with various detergents

    • Monodispersity assessment by size-exclusion chromatography

    • Limited proteolysis to identify stable domains

  • Crystallization methods comparison:

MethodPrincipleAdvantagesConsiderations
Vapor diffusionGradual concentration via vapor equilibrationTraditional, widely accessibleLower success rate with membrane proteins
Lipidic cubic phaseProtein reconstitution in lipidic mesophaseMimics native environment, highly successful for GPCRsTechnically challenging, specialized equipment needed
Bicelle crystallizationProtein in disc-shaped lipid-detergent micellesIntermediate between detergent and LCP methodsComposition optimization critical
In meso crystallizationReconstitution into lipidic mesophasesStabilizes membrane proteinsComplex setup, difficult crystal harvesting
  • Additive screening: Systematically test lipids, cholesterol derivatives, and specific binding partners that may stabilize the protein.

  • Surface engineering: Consider introducing mutations to create crystal contacts or fusion proteins (e.g., T4 lysozyme) to enhance crystallizability.

  • Alternative approaches: If crystallization proves challenging, explore single-particle cryo-EM or solid-state NMR approaches.

What strategies can identify potential binding partners of Csal_1895?

Multiple complementary approaches should be employed to identify interaction partners:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express tagged Csal_1895 in native or heterologous systems

    • Perform crosslinking prior to solubilization if interactions are transient

    • Use appropriate controls (tag-only, inactive mutants) to filter non-specific interactions

    • Quantitative MS approaches (SILAC, TMT) increase confidence in results

  • Proximity labeling approaches:

    • BioID or APEX2 fusion proteins expressed in cellular context

    • Biotinylation of proximal proteins followed by streptavidin pulldown

    • MS identification of proximal proteins

  • Yeast two-hybrid membrane adaptations:

    • Split-ubiquitin membrane yeast two-hybrid

    • MYTH (membrane yeast two-hybrid) system

    • Screen against genomic libraries from Chromohalobacter salexigens

  • Computational predictions:

    • Protein-protein interaction networks

    • Genomic context analysis (gene neighborhood, fusion events)

    • Co-expression data analysis

  • Validation experiments:

    • Co-immunoprecipitation

    • FRET/BRET assays

    • Microscopy-based co-localization

    • Functional complementation studies

How can researchers assess the impact of specific mutations on Csal_1895 function?

A comprehensive mutational analysis approach should include:

  • Rational mutation design based on:

    • Sequence conservation analysis across orthologs

    • Structural predictions or experimental structures

    • Computational hotspot identification

    • Physicochemical property considerations

  • High-throughput mutagenesis approaches:

    • Alanine-scanning mutagenesis of transmembrane regions

    • Deep mutational scanning coupled with functional selection

    • CRISPR-based saturation mutagenesis in native context

  • Functional readouts:

    • Protein expression and membrane localization assessment

    • Thermal stability comparisons (DSF, CPM assays)

    • Binding assays if ligands are known

    • Activity assays based on predicted function

  • Structural impact evaluation:

    • Circular dichroism to assess secondary structure changes

    • Intrinsic fluorescence for tertiary structure assessment

    • HDX-MS to identify regions with altered dynamics

    • MD simulations to predict conformational impacts

  • Data integration:

    • Correlation of sequence conservation with mutational sensitivity

    • Mapping of sensitive positions onto structural models

    • Identification of functional domains and critical residues

How can computational approaches predict and model Csal_1895 function?

Advanced computational methods provide valuable insights into membrane protein function:

  • Homology modeling and threading approaches:

    • Identify structural templates despite low sequence identity

    • Generate models using membrane-protein specific protocols

    • Validate models using implicit membrane energy functions

  • Molecular dynamics simulations:

    • Embed protein models in explicit lipid bilayers

    • Perform extended simulations (100ns-1μs) to observe conformational dynamics

    • Identify potential water/ion channels or substrate binding sites

    • Apply enhanced sampling techniques (metadynamics, umbrella sampling) for energy landscapes

  • Machine learning applications:

    • Predict functional sites using conservation patterns and physicochemical properties

    • Identify potential ligand binding pockets

    • Apply deep learning models trained on membrane protein datasets

  • Network-based function prediction:

    • Integrate protein-protein interaction data

    • Analyze genomic context and co-expression networks

    • Implement guilt-by-association approaches across species

  • Virtual screening for functional validation:

    • Dock compound libraries to identified binding sites

    • Predict binding affinities and interaction patterns

    • Select candidates for experimental validation

These computational predictions generate testable hypotheses that can guide experimental design and accelerate functional characterization.

What are the best approaches for reconstituting Csal_1895 into artificial membrane systems?

Reconstitution into artificial membrane systems enables functional studies in controlled environments:

  • Liposome reconstitution:

    • Optimize lipid composition (consider native C. salexigens membrane lipids)

    • Compare detergent removal methods: dialysis, Bio-Beads, cyclodextrin

    • Monitor protein orientation using protease protection assays

    • Assess protein:lipid ratios for optimal activity

  • Nanodiscs preparation:

    • Select appropriate membrane scaffold protein (MSP) variants

    • Optimize MSP:lipid:protein ratios

    • Characterize by size-exclusion chromatography and negative-stain EM

    • Enable single-molecule studies and controlled stoichiometry

  • Proteoliposome functional assays:

    • Develop fluorescence-based assays for transport/channel activity

    • Implement counterflow assays if Csal_1895 is a transporter

    • Design assays with physiologically relevant conditions (salt, pH)

  • Polymer-based systems:

    • Amphipols for increased stability

    • Styrene-maleic acid lipid particles (SMALPs) for native lipid co-extraction

    • Characterize by analytical ultracentrifugation and cryo-EM

  • Quality control metrics:

    • Size distribution (DLS, NTA)

    • Freeze-fracture electron microscopy for protein incorporation

    • Fluorescence recovery after photobleaching for mobility assessment

    • Circular dichroism to confirm retention of secondary structure

How can researchers develop soluble functional analogues of Csal_1895 for biotechnological applications?

The development of soluble functional analogues represents a cutting-edge approach with significant biotechnological potential:

This approach has demonstrated high experimental success rates and represents a de facto expansion of the functional soluble fold space .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.