Recombinant Chrysanthemum virus B Movement protein TGB2 (ORF3)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Chrysanthemum Virus B Movement Protein TGB2 (ORF3)

Recombinant Chrysanthemum virus B Movement protein TGB2 (ORF3) is a bioengineered protein derived from Chrysanthemum virus B (CVB), a member of the Carlavirus genus. This protein is part of the triple gene block (TGB) in viral genomes, which facilitates intracellular movement of the virus within infected plants. The recombinant form is produced in E. coli and includes an N-terminal His-tag for purification and structural stability .

Amino Acid Sequence and Domain Structure

The TGB2 protein (UniProt ID: P37989) spans 106 amino acids (1–106 aa) with the sequence:
MPLTPPPDHTKVLLVAAIGLSIVASILTYSRNTLPQVGDHSHLLPHGGVYKDGTKTIVYGGPRKLNSLEGGFNLPVQPWFLVILLSAAIFLLSCRSGHRRVCGQCH .
Key features include:

  • His-tag: Facilitates affinity chromatography for purification.

  • Hydrophobic regions: Critical for interactions with viral RNA or host cell components during movement.

Functional Role

TGB2 is essential for:

  1. Viral movement: Coordinates with TGB1 (RNA-binding) and TGB3 (cell-to-cell transport) to ensure systemic infection.

  2. Host-virus interaction: Modulates plant defense mechanisms to enable viral replication.

Production Methodology

ParameterDetails
Expression HostE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
Storage Conditions-20°C/-80°C (long-term); 4°C for working aliquots (≤1 week)

Key Applications

  • Diagnostic assays: Used in ELISA kits for detecting CVB infections .

  • Transgenic resistance studies: Serves as a target for RNA interference (RNAi) or CRISPR-based resistance in chrysanthemums .

Genetic Diversity of CVB Isolates

A 2022 study identified highly divergent CVB isolates (e.g., GS1, GS2) with recombination events in the replicase gene, suggesting rapid evolution . For example:

  • Recombination event: A 3,720-nt segment in the CVB isolate FY genome was linked to an Indian isolate (Uttar Pradesh) .

  • CVR co-infection: CVR (a closely related virus) was detected in Russian chrysanthemums, expanding its geographic range beyond China .

Transgenic Resistance

Transgenic chrysanthemums expressing RNAi constructs targeting TGB2 showed reduced CVB infection rates. Western blot and DAS-ELISA assays confirmed reduced viral loads in lines like pRNAIVB5 and pRNAIVB18 .

ELISA-Based Detection

Recombinant TGB2 is used in ELISA kits to quantify CVB in infected plants. A study using 50 µg of purified protein achieved high specificity in detecting viral antigens .

Virus Elimination Strategies

Current methods include:

  1. Heat therapy: Reduces viral load in infected plants.

  2. Chemotherapy: Antiviral agents targeting viral replication.

  3. Meristem culture: Removes viruses from shoot tips for clean plant propagation .

Challenges and Future Directions

  • Complex infections: CVB often co-occurs with other viruses (e.g., CVR, TAV), complicating diagnostic and resistance strategies .

  • Resistance breeding: Engineering TGB2-targeted resistance in chrysanthemums remains critical, as natural resistance is rare .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them when placing your order. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
ORF3; Movement protein TGB2; 12 kDa protein; Triple gene block 2 protein; TGBp2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-106
Protein Length
full length protein
Species
Chrysanthemum virus B (CVB)
Target Names
ORF3
Target Protein Sequence
MPLTPPPDHTKVLLVAAIGLSIVASILTYSRNTLPQVGDHSHLLPHGGVYKDGTKTIVYG GPRKLNSLEGGFNLPVQPWFLVILLSAAIFLLSCRSGHRRVCGQCH
Uniprot No.

Target Background

Function
This protein plays a crucial role in viral cell-to-cell propagation. It facilitates genome transport to adjacent plant cells through plasmodesmata.
Protein Families
Tymovirales TGBp2 protein family
Subcellular Location
Host endoplasmic reticulum membrane.

Q&A

What is the structural and functional significance of the TGB2 protein within the Chrysanthemum virus B genome?

TGB2 is encoded by ORF3 and constitutes a critical component of the triple gene block (TGB) within the Chrysanthemum virus B genome. The TGB consists of three overlapping open reading frames (ORF2, ORF3, and ORF4) that encode TGB1, TGB2, and TGB3 proteins respectively . These proteins function cooperatively as a movement complex facilitating cell-to-cell transport of viral particles through plasmodesmata.

TGB2 specifically is a membrane-associated protein that localizes to the endoplasmic reticulum and likely participates in the formation of viral movement complexes. Unlike other structural proteins such as the coat protein (which has been shown to be involved in capsid formation through the interaction of amino acids 98-184 ), TGB2's primary function appears to be facilitating intercellular viral movement rather than particle assembly.

What detection methods are most effective for confirming the expression of recombinant CVB TGB2 protein in experimental systems?

Several complementary approaches can be employed to confirm successful expression of recombinant CVB TGB2:

  • RT-PCR detection: Using primers specific to the TGB region of the CVB genome allows for reliable detection of viral transcripts. For example, studies of Russian CVB isolates used specific primer combinations to amplify viral genome segments, which could be adapted to specifically target the TGB2 region .

  • Immunological detection: Western blotting using antibodies raised against the TGB2 protein or epitope tags incorporated into recombinant constructs. This approach has been effectively employed in protein interaction studies of CVB coat protein using tagged constructs .

  • Fluorescence microscopy: For localization studies, fusion of TGB2 with fluorescent proteins allows visualization of subcellular distribution patterns characteristic of membrane-associated viral movement proteins.

  • Mass spectrometry: For definitive protein identification and characterization of post-translational modifications.

The detection methodology should be selected based on experimental objectives, with RT-PCR offering high sensitivity for transcript detection and immunological methods providing confirmation of protein expression.

What expression systems are optimal for producing functional recombinant CVB TGB2 protein for in vitro studies?

The optimal expression system for recombinant CVB TGB2 depends on downstream applications and required protein properties. Based on established methodologies for similar viral proteins, researchers should consider:

Bacterial expression systems:

  • E. coli BL21(DE3) - Suitable for high-yield production when protein folding is not complex

  • E. coli Rosetta - Recommended when codon optimization is necessary for efficient expression

Eukaryotic expression systems:

  • Yeast (S. cerevisiae, P. pastoris) - Provides eukaryotic post-translational modifications and membrane association capabilities, crucial for TGB2 functionality

  • Insect cell/baculovirus systems - Offers high expression levels with proper protein folding and post-translational modifications

For functional studies of membrane-associated viral proteins like TGB2, eukaryotic expression systems typically yield better results due to proper membrane targeting and folding. The yeast expression system has been successfully employed for CVB coat protein interaction studies and would likely be suitable for TGB2 expression as well.

The expression construct design should include:

  • An appropriate signal sequence if necessary for membrane targeting

  • Purification tags positioned to avoid interference with protein function

  • Consideration of codon optimization for the chosen expression system

What are the key methodological considerations for studying TGB2-mediated membrane interactions in relation to viral movement?

Studying TGB2-membrane interactions requires specialized approaches to preserve and analyze membrane associations:

  • Subcellular fractionation techniques:

    • Differential centrifugation to isolate membrane fractions

    • Sucrose gradient separation of different cellular compartments

    • Detergent-based extraction to distinguish peripheral vs. integral membrane associations

  • Microscopy approaches:

    • Confocal microscopy with fluorescent protein fusions to track localization

    • Transmission electron microscopy with immunogold labeling for high-resolution localization

    • Live-cell imaging to monitor dynamic association with membrane compartments

  • Biochemical characterization:

    • Protease protection assays to determine membrane topology

    • Alkaline extraction to distinguish peripheral from integral membrane proteins

    • Lipid binding assays to identify specific lipid interactions

  • Mutation analysis:

    • Systematic mutation of hydrophobic domains to identify membrane-spanning regions

    • Mutagenesis of potential phosphorylation sites that might regulate membrane association

When designing these experiments, researchers should consider controls that distinguish specific TGB2-membrane interactions from non-specific hydrophobic associations, particularly when working with recombinant proteins that may aggregate if improperly folded.

What mutation strategies are most informative for structure-function analysis of CVB TGB2 protein?

Based on approaches used in related viral movement proteins, the following mutation strategies can yield valuable insights into TGB2 function:

Targeted mutation approaches:

  • Alanine-scanning mutagenesis - Systematic replacement of amino acid clusters with alanine to identify functional domains

  • Hydrophobic domain mutations - Alterations to putative transmembrane domains to assess membrane association

  • Conserved motif targeting - Identification and mutation of motifs conserved among carlavirus TGB2 proteins

  • Phosphorylation site mutations - Modification of predicted phosphorylation sites to analyze regulation

Domain-swapping approaches:

  • Exchange domains between TGB2 proteins from different carlaviruses to identify species-specific functions

  • Create chimeric proteins with TGB2 from related virus groups (potexviruses, hordeiviruses) to identify conserved functional elements

Truncation analysis:
Similar to the approach used for CVB coat protein , generating a series of N-terminal and C-terminal truncations can help map functional domains involved in protein-protein interactions, membrane association, and subcellular targeting.

Mutation TypeTarget RegionExpected OutcomeAnalytical Method
Alanine substitutionConserved motifsIdentify essential residues for functionViral movement assays
Hydrophobic domain alterationsPredicted transmembrane regionsDetermine membrane topologyMembrane fractionation
Phosphomimic mutationsSer/Thr residuesAssess regulation by phosphorylationProtein localization studies
TruncationsN- and C-terminiMap interaction domainsYeast two-hybrid or Co-IP

How do sequence variations in TGB2 across different CVB isolates correlate with differences in virulence and host range?

Comparative genomic analysis of CVB isolates reveals significant variation that may influence viral biology. Russian studies have identified highly divergent CVB isolates (such as GS1 and GS2) with considerable sequence variation , providing a foundation for structure-function correlation studies.

The relationship between TGB2 sequence variation and biological properties can be investigated through:

  • Sequence alignment and phylogenetic analysis:

    • Multiple sequence alignment of TGB2 sequences from various isolates

    • Identification of conserved vs. variable regions

    • Correlation of sequence clusters with geographical distribution or host range

  • Recombination analysis:

    • Identification of potential recombination events within the TGB region

    • Assessment of whether recombination contributes to host adaptation

  • Selection pressure analysis:

    • Calculation of dN/dS ratios to identify regions under positive or negative selection

    • Mapping selection hotspots to functional domains

  • Host range correlation:

    • Experimental testing of different isolates' TGB2 proteins in plant infection assays

    • Swapping TGB2 sequences between isolates with different host preferences to identify determinants

Based on the observation that highly divergent CVB isolates exist , researchers should investigate whether TGB2 sequence variations correlate with differences in intercellular movement efficiency, which could directly impact viral spread and symptom development.

What approaches can resolve contradictory data regarding the role of TGB2 phosphorylation in regulating viral movement?

Phosphorylation of viral movement proteins often regulates their function, but data regarding TGB2 modification may be contradictory. To resolve such discrepancies, researchers should implement a multi-faceted approach:

  • Comprehensive phosphorylation site mapping:

    • Mass spectrometry analysis of TGB2 expressed in plant systems

    • Comparison of phosphorylation patterns in different host species

    • Temporal analysis during infection progression

  • Functional validation of phosphorylation:

    • Generation of phosphomimetic (S/T→D/E) and phosphodeficient (S/T→A) mutants

    • Assessment of mutant effects on:

      • Protein localization

      • Membrane association

      • Interaction with other TGB proteins

      • Viral movement in plant tissues

  • Host kinase identification:

    • Kinase inhibitor screening to identify involved signaling pathways

    • Co-immunoprecipitation to identify interacting host kinases

    • In vitro kinase assays to confirm direct phosphorylation

  • Integration with structural data:

    • Molecular modeling to predict how phosphorylation alters protein conformation

    • Analysis of whether phosphorylation sites are located at interaction interfaces

Contradictory results may arise from differences in experimental systems, host species, or viral isolates. Researchers should standardize experimental conditions and include appropriate controls to identify the source of discrepancies.

How can advanced imaging techniques be integrated to elucidate the dynamic behavior of TGB2 during different stages of viral infection?

Advanced imaging approaches provide powerful tools for tracking TGB2 dynamics during infection:

  • Super-resolution microscopy techniques:

    • Structured illumination microscopy (SIM) for enhanced resolution of membrane structures

    • Stochastic optical reconstruction microscopy (STORM) for single-molecule localization

    • Stimulated emission depletion (STED) microscopy for nanoscale visualization of protein complexes

  • Live-cell imaging approaches:

    • Fluorescence recovery after photobleaching (FRAP) to measure protein mobility

    • Förster resonance energy transfer (FRET) to detect protein-protein interactions in vivo

    • Photoactivatable fluorescent proteins to track protein movement over time

  • Correlative light and electron microscopy (CLEM):

    • Integration of fluorescence localization with ultrastructural context

    • Immunogold labeling for precise localization at plasmodesmata and membrane structures

  • Multi-channel imaging for colocalization studies:

    • Simultaneous visualization of TGB2 with cellular markers for:

      • Endoplasmic reticulum

      • Golgi apparatus

      • Plasmodesmata

      • Other viral proteins (TGB1, TGB3, coat protein)

A comprehensive imaging strategy would involve time-course studies capturing TGB2 dynamics from early expression through cell-to-cell movement phases. This approach can resolve contradictions in static localization data by revealing the temporal sequence of TGB2 trafficking and interactions.

How do research findings on recombinant CVB TGB2 compare with TGB2 proteins from other members of the Carlavirus genus?

Comparative analysis of TGB2 proteins across the Carlavirus genus reveals both conserved features and virus-specific adaptations:

FeatureCVB TGB2Other Carlavirus TGB2 ProteinsFunctional Significance
Size~12 kDaGenerally 11-13 kDaConserved functional constraints
Membrane associationER-targetingPredominantly ER-associatedConserved role in viral transport complex
Conserved motifs[Based on sequence analysis]Hydrophobic domains, conserved residues between transmembrane segmentsEssential for function across genus
Variability regions[Based on sequence analysis]C-terminal region often more variablePossible host-specific adaptations

The overlapping organization of ORF2, ORF3, and ORF4 into the triple gene block is conserved across carlaviruses , suggesting fundamental constraints on TGB2 evolution due to coding sequence overlap with TGB1 and TGB3.

Future research directions should address:

  • Whether functional differences exist between CVB TGB2 and TGB2 proteins of other carlaviruses

  • How sequence conservation patterns correlate with specific functions in viral movement

  • Whether recombination events involving the TGB region occur between different carlaviruses

What paradoxes exist in current understanding of CVB TGB2 function, and how might they be resolved through new experimental approaches?

Several paradoxes in our understanding of TGB2 function require resolution:

  • Membrane association vs. plasmodesmatal targeting paradox:

    • TGB2 has characteristics of an integral membrane protein but must somehow facilitate transport through plasmodesmata

    • Resolution approach: Live-cell imaging combined with photo-switchable fluorescent proteins to track individual protein trajectories

  • Conservation vs. host adaptation paradox:

    • TGB2 is relatively conserved among carlaviruses but must adapt to different host cellular environments

    • Resolution approach: Comparative analysis of TGB2 function in different host species, identifying host factors that interact with TGB2

  • Individual function vs. cooperative action paradox:

    • TGB2 likely has specific biochemical functions but operates as part of a cooperative TGB complex

    • Resolution approach: Reconstitution of the complete TGB complex in vitro using purified components to measure emergent properties

  • Structure-function relationship paradox:

    • Membrane proteins like TGB2 are difficult to crystallize, limiting structural understanding

    • Resolution approach: Integration of cryo-electron microscopy with molecular dynamics simulations and in vivo functional studies

New experimental approaches to resolve these paradoxes include:

  • Single-molecule tracking in living plant cells

  • Proximity labeling techniques to identify transient interaction partners

  • Hydrogen-deuterium exchange mass spectrometry to probe protein dynamics

  • CRISPR-based screens to identify host factors required for TGB2 function

What integrative research strategies would advance understanding of how CVB TGB2 contributes to virus-host interactions at the molecular level?

Advancing our understanding of CVB TGB2 function in virus-host interactions requires integrative approaches combining multiple disciplines:

  • Multi-omics integration:

    • Transcriptomics: Identifying host genes differentially expressed in response to TGB2

    • Proteomics: Characterizing the TGB2 interactome using proximity labeling approaches

    • Metabolomics: Assessing changes in cellular metabolism induced by TGB2 expression

    • Structural biology: Determining TGB2 structure and conformational dynamics

  • Plant-virus interaction network mapping:

    • Systematic screening for host proteins interacting with TGB2

    • Analysis of how these interactions differ between resistant and susceptible hosts

    • Comparison with interaction networks of TGB2 proteins from other viruses

  • Translation to applied outcomes:

    • Development of TGB2-based strategies for virus resistance

    • Design of inhibitory peptides or compounds targeting essential TGB2 functions

    • Engineering modified TGB2 variants for biotechnological applications

  • Synthetic biology approaches:

    • Construction of minimal synthetic systems to reconstitute TGB2-mediated transport

    • Development of biosensors based on TGB2 properties

    • Creation of inducible expression systems to study TGB2 toxicity thresholds

These integrative strategies would benefit from collaborative approaches combining expertise in plant virology, cell biology, structural biology, and computational modeling to develop a comprehensive understanding of TGB2 function in the context of the virus life cycle and plant immune responses.

What are the major technical challenges in expressing and purifying functional CVB TGB2 protein, and how can they be overcome?

Membrane proteins like TGB2 present significant challenges for expression and purification:

  • Expression challenges:

    • Toxicity to expression hosts due to membrane association

    • Improper folding in heterologous systems

    • Low expression levels

  • Purification challenges:

    • Requirement for detergents or amphipols for extraction

    • Potential loss of functional conformation during solubilization

    • Aggregation during concentration

Recommended solutions:

  • Expression optimization:

    • Use of inducible expression systems with tight regulation

    • Fusion with solubility-enhancing tags (MBP, SUMO)

    • Expression as split domains if full-length protein is toxic

    • Testing multiple expression hosts (bacterial, yeast, insect cells)

  • Purification strategies:

    • Detergent screening to identify optimal extraction conditions

    • Nanodisc reconstitution to maintain native membrane environment

    • On-column refolding protocols if inclusion bodies form

    • Size-exclusion chromatography to remove aggregates

  • Functional validation:

    • Development of activity assays to confirm proper folding

    • Circular dichroism to verify secondary structure content

    • Binding assays with known interaction partners

Similar challenges have been addressed in studies of viral coat proteins, where specific domains responsible for protein-protein interactions were identified through carefully designed constructs and interaction assays .

How can researchers effectively address contradictory results from different experimental systems when studying CVB TGB2?

Contradictory results across experimental systems are common in viral protein research. Effective resolution strategies include:

  • Standardization of experimental conditions:

    • Use of identical CVB isolates across laboratories

    • Standardized protocols for protein expression and purification

    • Consistent plant growth and infection conditions

  • Comprehensive comparison of methodologies:

    • Side-by-side testing of different expression systems

    • Comparison of in vitro vs. in vivo results

    • Documentation of all experimental variables

  • Collaborative multi-laboratory validation:

    • Blind testing of key results in independent laboratories

    • Development of standard reference materials

    • Establishment of positive and negative controls

  • Integration of multiple complementary techniques:

    • Confirmation of protein-protein interactions by several methods (Y2H, Co-IP, FRET)

    • Validation of localization by different microscopy approaches

    • Cross-confirmation of functional assays

  • Metadata reporting standards:

    • Complete documentation of experimental conditions

    • Sharing of raw data and analysis methods

    • Transparent reporting of failed approaches

Researchers should recognize that contradictions may reflect genuine biological complexity rather than experimental errors. For example, the function of TGB2 may be context-dependent, varying with host species, developmental stage, or environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.