Recombinant Cicer arietinum ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Definition and Biochemical Role

Recombinant Cicer arietinum ATP synthase subunit a (atpI) is a chloroplast-specific component of the F₀ sector in plant ATP synthase complexes. This subunit facilitates proton translocation across the thylakoid membrane, coupling electrochemical gradients to ATP synthesis. In chloroplasts, ATP synthase operates reversibly, synthesizing ATP during photosynthesis and hydrolyzing it under low light conditions . Subunit a interacts with subunit c (forming the c-ring) to create the proton channel, with its oligomeric state determining proton-to-ATP stoichiometry .

Recombinant Production and Purification

The recombinant atpI protein is produced via heterologous expression systems, primarily in E. coli, yeast, baculovirus, or mammalian cells . Key production parameters include:

ParameterDetailsSource
Host SystemsE. coli, yeast, baculovirus, mammalian cells
Purity≥85% as determined by SDS-PAGE
ApplicationsStructural studies, functional assays, and protein-protein interaction analysis

Post-expression, purification methods include affinity chromatography (e.g., Strep-tag or His-tag systems) and gel filtration to isolate monomeric or oligomeric forms .

Comparative Analysis with Other Organisms

OrganismHost SystemPurityKey Findings
Cicer arietinumE. coli≥85%Limited data; inferred roles from homologs
Bacillus pseudofirmusE. coliAtpI stabilizes c-ring and F₁ membrane association
Spinacia oleraceaE. coliSubunit c reconstitution for oligomer studies

Challenges and Future Directions

  • Limited Native Studies: Most data derive from bacterial or chloroplast models; C. arietinum-specific studies are needed.

  • Functional Specialization: Host-specific expression systems may influence post-translational modifications (e.g., acylation) .

  • Biotechnological Potential: Recombinant atpI could advance bioengineering of ATP synthase for enhanced photosynthetic efficiency or biofuel production .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Cicer arietinum (Chickpea) (Garbanzo)
Target Names
atpI
Target Protein Sequence
MNVLLCSINTLNRFYDISALEVGQHFYWQIGDFQVHAQVLITSWVVIAILLISTILVVRN PQTIPTSGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTLFLFIFVSNWSGALLPWKII KLPHGELAAPTNDINTTVALALLTSVAYFYAGISKKGLAYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVIPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function

Key component of the proton channel; it plays a direct role in proton translocation across the membrane.

Database Links

KEGG: cam:6797466

Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of ATP synthase subunit a (atpI) in chloroplasts?

ATP synthase subunit a (atpI) is a membrane protein that forms part of the F0 domain of the chloroplastic ATP synthase complex. It plays a critical role in the proton translocation pathway necessary for ATP synthesis. The protein helps establish the proton channel through which H+ ions flow down their electrochemical gradient from the thylakoid lumen to the stroma. This proton movement drives the rotary mechanism of the ATP synthase, coupling the energy from the proton motive force to the synthesis of ATP from ADP and inorganic phosphate . Unlike some other ATP synthase subunits, atpI appears to have a supportive rather than essential role in the assembly and stability of the ATP synthase complex, as demonstrated in studies with alkaliphilic Bacillus pseudofirmus OF4 .

How does recombinant Cicer arietinum atpI compare structurally to atpI from other plant species?

While the search results don't provide specific structural comparison data for Cicer arietinum atpI versus other plant species, research on ATP synthase components across species reveals that the core structures are generally conserved with species-specific adaptations. The atpI protein maintains structural similarity across plant species while potentially exhibiting sequence variations that may affect assembly efficiency or stability under different physiological conditions.

Comparison studies of ATP synthase components have shown that interactions between subunits, such as between alpha and beta subunits, are critical for function. For example, in spinach chloroplast ATP synthase, the cysteine residue at position 63 in beta subunit is located at the interface with alpha subunit and is conformationally coupled to the nucleotide binding site . Similar interaction points likely exist in the Cicer arietinum ATP synthase complex, although specific data on atpI interaction sites would require experimental determination.

What role does atpI play in ATP synthase assembly compared to other assembly factors?

The atpI protein serves a chaperone-like function in ATP synthase assembly, although it is not absolutely essential for complex formation in all organisms. Studies in alkaliphilic Bacillus pseudofirmus OF4 revealed that deletion of atpI led to reduced stability of the ATP synthase rotor, reduced membrane association of the F1 domain, reduced ATPase activity, and modestly reduced nonfermentative growth, but did not completely prevent ATP synthase assembly .

This contrasts with earlier findings by Yoshida and colleagues who showed that AtpI plays a necessary and sufficient chaperone-like role in assembly of a hybrid Na+-coupled ATP synthase. In their system, formation of a functional c-ring rotor required AtpI co-expression .

The assembly of ATP synthase also involves YidC/OxaI/Alb3 family proteins, which facilitate membrane protein insertion. In B. pseudofirmus OF4, the YidC homologs SpoIIIJ and YqjG showed functional overlap but distinct contributions to ATP synthase assembly and function under different pH conditions, with YqjG playing a greater role at pH 7.5 and SpoIIIJ at pH 10.5 .

What expression systems are typically used for producing recombinant Cicer arietinum atpI?

Based on general recombinant protein production practices and information from the search results, expression of recombinant ATP synthase components typically employs bacterial expression systems such as Escherichia coli. The search results indicate that CUSABIO TECHNOLOGY LLC is a supplier of recombinant Cicer arietinum ATP synthase subunit b (although not specifically subunit a) .

When expressing membrane proteins like atpI, researchers must consider several factors:

  • Expression host compatibility

  • Proper membrane insertion

  • Post-translational modifications

  • Protein folding requirements

For functional studies, both in vivo expression in bacterial hosts and in vitro cell-free synthesis systems have been employed successfully for ATP synthase components . In vitro expression systems have been particularly useful for studying assembly requirements, as demonstrated with P. modestum and Caldalkalibacillus thermarum TA2.A1 ATP synthases .

How do mutations in the atpI gene affect ATP synthase assembly and function in Cicer arietinum chloroplasts?

While specific mutation studies in Cicer arietinum atpI are not detailed in the search results, research on ATP synthase in other organisms provides insights into how mutations might affect function. Studies in alkaliphilic B. pseudofirmus OF4 demonstrated that deletion of atpI reduced ATP synthase stability and activity without completely preventing assembly . Similar effects might be expected in Cicer arietinum, though plant-specific differences would likely exist.

Site-directed mutagenesis studies of ATP synthase components have revealed critical functional regions. For example, enlarging the side chain at position 63 in spinach chloroplast beta subunit from cysteine to tryptophan blocked ATP synthesis in vivo without significantly impairing ATPase activity or ADP binding in vitro . This suggests that specific amino acid changes can disrupt the coupling between catalytic sites and proton movement.

For atpI, mutations would likely affect:

  • Interaction with c-ring components during assembly

  • Stability of the assembled ATP synthase complex

  • Efficiency of proton translocation

  • pH-dependent function of the ATP synthase

Research on these aspects would require generating specific atpI mutations and analyzing their effects on ATP synthase assembly, stability, and function through protein purification, activity assays, and structural studies.

What are the implications of atpI sequence variations across Cicer arietinum varieties for evolutionary adaptation?

Although the search results don't provide specific information about atpI sequence variations across Cicer arietinum varieties, research on chloroplast genes often reveals patterns of conservation and variation that reflect evolutionary pressures and adaptation to different environmental conditions.

ATP synthase must function efficiently under variable light conditions, temperature ranges, and other environmental stresses. Sequence variations in atpI across chickpea varieties might reflect adaptations to different growing environments, such as drought tolerance, temperature adaptation, or optimization for different photosynthetic requirements.

Analysis of such variations would typically involve:

  • Sequencing atpI from multiple Cicer arietinum varieties

  • Comparing sequence conservation with other legume species

  • Analyzing whether variations cluster in specific functional domains

  • Correlating sequence differences with environmental or physiological traits

  • Examining selection pressures through dN/dS ratio analysis

Structural biology approaches, including homology modeling based on known ATP synthase structures, could help predict the functional consequences of identified variations.

How does the interaction between atpI and other ATP synthase subunits differ in stress conditions?

The interaction between atpI and other ATP synthase subunits likely changes under various stress conditions, although specific data for Cicer arietinum are not provided in the search results. Studies in other systems suggest that environmental stresses such as temperature extremes, salinity, drought, or pH changes can affect ATP synthase assembly and stability.

Research in alkaliphilic B. pseudofirmus OF4 revealed that the contributions of different assembly factors to ATP synthase function varied with pH. At pH 7.5, YqjG played a greater role, while at pH 10.5, SpoIIIJ was more important . This suggests that different chaperones or assembly factors may be preferentially utilized under different stress conditions.

For plant chloroplasts, stress conditions might affect:

  • Efficiency of atpI-mediated assembly of the ATP synthase complex

  • Stability of interactions between atpI and other subunits

  • Post-translational modifications of atpI that influence its function

  • Expression levels of atpI or other ATP synthase components

Studying these aspects would require techniques such as co-immunoprecipitation, blue native PAGE, or crosslinking studies under various experimental conditions mimicking different stresses.

What is the relationship between plastome rearrangements and atpI function in Cicer arietinum?

The search results provide some insight into plastome rearrangements, although not specifically for Cicer arietinum atpI. Analysis of plastome structures has revealed that some species contain direct repeats (DRs) rather than the typical inverted repeats (IRs) found in most chloroplast genomes .

These structural rearrangements of the plastome can affect gene organization and expression. In Selaginella vardei, for example, a ~50-kb inversion resulted in a DR structure, which was confirmed by PCR experiments . Such rearrangements could potentially affect the expression and function of chloroplast genes including those encoding ATP synthase subunits.

For Cicer arietinum, researchers might investigate:

  • Whether atpI is located in a region susceptible to rearrangement

  • If any known plastome inversions or rearrangements affect atpI expression

  • Whether different Cicer varieties show plastome structure variations affecting ATP synthase genes

  • How any identified rearrangements affect chloroplast bioenergetics

Such studies would require whole plastome sequencing, comparative genomic analysis, and functional validation of gene expression and protein activity.

What are the optimal conditions for expressing and purifying functional recombinant Cicer arietinum atpI?

Based on general principles for membrane protein expression and information from the search results about ATP synthase components, the following methodological considerations are important for expressing and purifying functional recombinant Cicer arietinum atpI:

Expression System Selection:

  • Bacterial expression systems (E. coli) with specialized vectors for membrane proteins

  • Eukaryotic systems (yeast, insect cells) for more complex folding requirements

  • Cell-free expression systems, which have been successful for ATP synthase components

Expression Optimization Parameters:

ParameterRecommended ConditionsConsiderations
Temperature16-25°CLower temperatures often improve folding of membrane proteins
InductionLow inducer concentrationGradual induction prevents aggregation
MediaRich media with supplementsAddition of membrane-supporting components
Expression timeExtended (24-48h)Allows slower, more accurate protein folding

Purification Strategy:

  • Membrane isolation by differential centrifugation

  • Detergent screening for optimal solubilization (typically mild non-ionic or zwitterionic detergents)

  • Affinity chromatography using appropriate tags (His-tag has been used successfully for ATP synthase components )

  • Size exclusion chromatography to ensure homogeneity

  • Assessment of functional integrity

Successful expression may require co-expression with other ATP synthase components or chaperones, as studies have shown that AtpI interacts with c-subunits during assembly .

What techniques are most effective for studying atpI-mediated ATP synthase assembly in vitro?

Based on the approaches described in the search results, several techniques have proven effective for studying ATP synthase assembly:

In Vitro Translation Systems:
Cell-free expression systems have been successfully used to study ATP synthase assembly, including the dependence of c-ring formation on AtpI . These systems allow controlled expression of individual components and observation of assembly processes without cellular complexity.

Co-Expression Strategies:
Expression of multiple ATP synthase components from plasmid constructs has enabled study of assembly requirements. For example, Yoshida and colleagues used a hybrid ATP synthase construct to demonstrate AtpI's role in c-ring assembly .

Affinity Co-Purification:
His-tagged versions of AtpI have been used to co-purify interacting components like c-rings, demonstrating direct protein-protein interactions during assembly .

Activity Assays:
Functional assessment of assembled complexes through:

  • ATPase activity measurements

  • ATP synthesis assays

  • Proton pumping measurements

  • Ion transport assays

Structural Characterization:

  • Blue native PAGE for complex integrity

  • Electron microscopy for structural visualization

  • Mass spectrometry for subunit composition analysis

  • Crosslinking studies to map interaction interfaces

Research on alkaliphilic B. pseudofirmus OF4 demonstrated that comparing properties of ATP synthase from wild-type and mutant strains (with deletions in assembly factors) provides valuable insights into assembly mechanisms .

How can researchers effectively analyze the impact of environmental factors on atpI function?

To analyze environmental impacts on atpI function, researchers should consider the following methodological approaches:

Stress Treatment Experimental Design:

  • Controlled application of specific stresses (temperature, pH, salt, drought, light conditions)

  • Time-course analysis to distinguish immediate versus adaptive responses

  • Comparison of multiple Cicer arietinum varieties with different stress tolerances

Functional Assessment Methods:

  • ATP synthesis rate measurements under different conditions

  • Membrane potential analysis

  • Proton gradient formation efficiency

  • Oxygen evolution measurements (for photosynthetic activity)

Protein-Level Analysis:

  • Western blotting to quantify atpI expression

  • Blue native PAGE to assess complex stability

  • Co-immunoprecipitation to examine protein-protein interactions under stress

  • Post-translational modification analysis (phosphorylation, acetylation)

Genetic Approaches:

  • Generation of atpI variants with altered stress responses

  • Complementation studies in deletion mutants

  • Site-directed mutagenesis of key residues

Research on alkaliphilic B. pseudofirmus OF4 provides a model for such studies, as it demonstrated how mutations in assembly factors affected ATP synthase function across a pH range from near neutral to above pH 11 .

What are the key considerations when designing experiments to compare the roles of atpI versus YidC-like proteins in ATP synthase assembly?

Based on the comparative studies of AtpI and YidC-like proteins (SpoIIIJ and YqjG) in B. pseudofirmus OF4 , researchers should consider the following when designing similar experiments for Cicer arietinum:

Genetic Manipulation Strategies:

  • Generate single and combination deletion mutants of atpI and YidC homologs

  • Create complementation constructs with controlled expression levels

  • Consider conditional depletion systems for essential genes

Phenotypic Characterization Parameters:

Analysis TypeMeasurementsExpected Outcomes
Growth phenotypingGrowth rates under different conditionsIdentify condition-specific requirements
ATP synthase quantificationEnzyme yield from purificationAssess assembly efficiency
Activity assaysATPase activity, ATP synthesis ratesDetermine functional competence
Complex stabilityResistance to detergent or heatEvaluate structural integrity

Protein Interaction Studies:

  • Co-immunoprecipitation to identify interaction partners

  • Crosslinking to map interaction interfaces

  • Fluorescence microscopy with tagged proteins to visualize co-localization

Expression Analysis:

  • qRT-PCR to measure transcriptional responses

  • Western blotting to assess protein levels

  • Reporter gene fusions to monitor expression under different conditions

The study of B. pseudofirmus OF4 revealed that while AtpI and YidC homologs had distinct roles, there was also functional specialization among the YidC-like proteins, with YqjG and SpoIIIJ showing greater importance at pH 7.5 and 10.5, respectively . Similar condition-specific roles might exist in Cicer arietinum and should be investigated systematically.

What are the most promising future research directions for understanding atpI function in Cicer arietinum?

Based on current understanding of ATP synthase assembly and function, several promising research directions for Cicer arietinum atpI include:

  • Comparative genomic analysis of atpI across Cicer varieties to identify adaptive variations

  • Structural biology approaches to determine the three-dimensional structure of atpI and its interactions

  • Investigation of condition-specific assembly pathways under different environmental stresses

  • Exploration of the interplay between nuclear-encoded assembly factors and chloroplast-encoded ATP synthase components

  • Development of atpI variants with enhanced stability or efficiency for improved plant energy production

The findings from alkaliphilic bacteria suggest that ATP synthase assembly is a complex process involving multiple factors whose contributions vary with environmental conditions . Similar complexity likely exists in plant systems, with additional layers of regulation due to the endosymbiotic origin of chloroplasts and the distribution of ATP synthase genes between nuclear and plastid genomes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.