Recombinant Cicer arietinum NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Description

Function and Significance

NAD(P)H-quinone oxidoreductases (NQOs) are a class of enzymes that catalyze the reduction of quinones using NAD(P)H as an electron donor . In chloroplasts, these enzymes play a crucial role in various processes, including:

  • Photosynthesis: NQOs are involved in the electron transport chain, which is essential for photosynthesis . They facilitate the transfer of electrons from NAD(P)H to quinones, contributing to the generation of energy in the form of ATP and NADPH.

  • Redox Homeostasis: NQOs help maintain the balance of redox potential in chloroplasts . By reducing quinones, they prevent the accumulation of reactive oxygen species (ROS) that can cause oxidative damage to cellular components.

  • Stress Response: NQOs are implicated in the plant's response to environmental stresses, such as drought, salinity, and pathogen attack . They contribute to the detoxification of harmful compounds and the regulation of defense mechanisms.

Protein Properties

Recombinant Cicer arietinum NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic, exhibits the following characteristics:

PropertyDescription
SourceCicer arietinum (Chickpea)
Subcellular LocalizationChloroplast
Molecular WeightThe apparent molecular weight is around 49 kDa .
Purity>85% (SDS-PAGE)
FormLiquid or lyophilized
StorageLiquid form: 6 months at -20°C/-80°C; Lyophilized form: 12 months at -20°C/-80°C
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% glycerol for long-term storage .
SynonymsNAD(P)H dehydrogenase subunit 6, NADH-plastoquinone oxidoreductase subunit 6

Research Applications

Recombinant Cicer arietinum NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic, is a valuable tool for various research applications, including:

  • Enzyme Activity Assays: The recombinant protein can be used to study the enzymatic activity of NQOs and their role in redox reactions .

  • Protein-Protein Interactions: It can be employed to investigate the interactions of NQOs with other proteins in the chloroplast, providing insights into the structure and function of the enzyme complex .

  • Structural Studies: The recombinant protein can be used for structural studies, such as X-ray crystallography or NMR spectroscopy, to determine the three-dimensional structure of the enzyme.

  • Antibody Production: It can be used as an antigen to generate antibodies against Cicer arietinum NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic, which can be used for protein detection and localization studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Cicer arietinum (Chickpea) (Garbanzo)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDIFWTFLIISILIPILAFLISGILAPIRKGPEKLSSYESGIEPMGDAWLQFQI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLILIVGSVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H to plastoquinone via FMN and iron-sulfur (Fe-S) centers within the photosynthetic electron transport chain, and potentially within a chloroplast respiratory chain. In this species, plastoquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, thus conserving redox energy as a proton gradient.
Database Links

KEGG: cam:6797476

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Cicer arietinum NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic?

Recombinant Cicer arietinum NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic is a protein component of the NAD(P)H dehydrogenase complex located in chloroplasts of chickpea (Cicer arietinum). This enzyme belongs to the broader NAD(P)H dehydrogenase (quinone) family . The recombinant form refers to the protein produced through genetic engineering techniques, where the gene encoding this protein is isolated from chickpea and expressed in a different host organism to obtain purified protein for research purposes. The NQO3 subunit specifically contributes to the functional NDH complex in chloroplasts that participates in electron transport and redox reactions, primarily facilitating the reduction of quinones to hydroquinones .

What are the primary functions of NAD(P)H-quinone oxidoreductases in plants?

NAD(P)H-quinone oxidoreductases in plants serve several critical biochemical and physiological functions:

  • Electron transport: They participate in electron transfer chains within chloroplasts, using NAD(P)H as an electron donor to reduce quinones to hydroquinones .

  • Oxidative stress protection: Similar to their animal counterparts, plant NAD(P)H-quinone oxidoreductases help protect cells from oxidative damage by preventing the formation of reactive oxygen species (ROS) through the two-electron reduction of quinones, bypassing the formation of semiquinone radicals .

  • Cyclic electron flow: In chloroplasts, these enzymes can contribute to cyclic electron transport around photosystem I, helping to generate additional ATP without producing NADPH.

  • Stress response: Evidence suggests involvement in plant responses to various biotic and abiotic stresses, including pathogen defense mechanisms .

The methodological approach to studying these functions typically involves genetic manipulation (knockouts/overexpression), biochemical assays measuring enzyme activity, and physiological measurements of photosynthetic parameters under various conditions.

How does the structure of plant NAD(P)H-quinone oxidoreductases compare to mammalian homologs?

Plant NAD(P)H-quinone oxidoreductases share structural similarities with their mammalian counterparts while exhibiting distinct differences:

Similarities:

  • Both contain FAD as a cofactor for electron transfer reactions

  • Both function as multi-subunit complexes

  • Both catalyze the reduction of quinones to hydroquinones

Key differences:

  • Subcellular localization: Plant NQO3 is chloroplastic, while mammalian NQO1 is predominantly cytosolic

  • Quaternary structure: While mammalian NQO1 forms homodimers, plant chloroplastic NDH complexes involve multiple different subunits (including NQO3) forming larger complexes

  • Active site architecture: The human enzyme contains a characteristic tyrosine (Tyr-128) and loop (residues 232-236) that close the binding site after substrate or cofactor binding/release, controlling access to the catalytic site in accordance with the ping-pong mechanism

This structural comparison is based on crystallographic studies of human and mouse NQO1 at resolutions of 1.7Å and 2.8Å respectively, which revealed important conformational changes during substrate binding and catalysis .

What experimental techniques are commonly used to study Recombinant Cicer arietinum NAD(P)H-quinone oxidoreductase?

Several complementary experimental approaches are employed to study this enzyme:

  • Recombinant protein expression and purification:

    • Heterologous expression in bacterial systems (E. coli) or insect cell lines

    • Affinity chromatography using tags (His-tag, GST-tag)

    • Size exclusion chromatography for oligomeric state determination

  • Functional characterization:

    • Spectrophotometric enzyme assays measuring NAD(P)H oxidation or quinone reduction

    • Kinetic analysis to determine Km, Vmax, and substrate preferences

    • Inhibitor studies to probe catalytic mechanisms

  • Structural analysis:

    • X-ray crystallography for 3D structure determination

    • Circular dichroism for secondary structure analysis

    • Differential scanning calorimetry for thermal stability assessment

  • In planta studies:

    • Western blot analysis using specific antibodies (e.g., with dilutions of 1:1000)

    • Immunolocalization to confirm chloroplastic localization

    • Gene expression analysis using quantitative PCR (qPCR)

  • Genetic approaches:

    • CRISPR/Cas9-mediated gene editing

    • RNAi-based gene silencing

    • Complementation studies in knockout lines

The detection of these proteins in plant tissues typically employs Western blot techniques, with recommended antibody dilutions of approximately 1:1000 as reported for related NAD(P)H-quinone oxidoreductase subunits .

What role might NAD(P)H-quinone oxidoreductase play in Ascochyta blight resistance in chickpea?

Ascochyta blight (AB), caused by the fungal pathogen Ascochyta rabiei, is a significant disease affecting chickpea production globally . Research suggests potential associations between NAD(P)H-quinone oxidoreductase activity and disease resistance mechanisms:

  • Gene expression evidence: Transcriptional analysis using qPCR has shown that several receptor-like kinases (RLKs) located in the AB4.1 QTL region, including serine/threonine receptor-like kinases, are significantly induced in resistant chickpea lines after A. rabiei inoculation . Although NAD(P)H-quinone oxidoreductase was not specifically identified in this region, changes in redox enzymes often accompany disease response.

  • Potential mechanisms:

    • Redox signaling pathway modulation during pathogen recognition

    • Detoxification of fungal quinone toxins produced by A. rabiei

    • Contribution to ROS homeostasis during defense responses

    • Support of increased energy demands during pathogen defense

  • Experimental approach to investigate this hypothesis:

    • Compare expression levels of NAD(P)H-quinone oxidoreductase genes between resistant and susceptible chickpea lines after pathogen challenge

    • Analyze enzyme activity in response to fungal elicitors or A. rabiei extract

    • Perform virus-induced gene silencing or CRISPR-mediated knockouts of the gene to assess impact on disease susceptibility

    • Complement susceptible lines with the recombinant protein to test for restored resistance

Research by Lehti-Shiu et al. (2009) and Lin et al. (2015) has demonstrated that plant defense responses often involve receptor-like kinases and oxidoreductases working in concert to coordinate the early immune response .

How can recombinant expression systems be optimized for high-yield production of functional Cicer arietinum NAD(P)H-quinone oxidoreductase subunit 3?

Optimizing recombinant expression of this chloroplastic enzyme requires addressing several technical challenges:

  • Selection of expression system:

    • E. coli: Advantages include rapid growth and high yields, but may lack proper folding for chloroplastic proteins

    • Insect cells: Better for complex eukaryotic proteins but lower yields

    • Plant-based expression systems: More native-like post-translational modifications

  • Construct design considerations:

    • Remove chloroplast transit peptide sequence for cytosolic expression

    • Codon optimization for the host expression system

    • Addition of solubility tags (MBP, SUMO, TrxA) to enhance folding

    • Inclusion of appropriate affinity tags for purification (His6, GST, FLAG)

  • Expression conditions optimization:

    • Temperature: Lower temperatures (16-18°C) often improve folding

    • Induction parameters: IPTG concentration and induction time

    • Media composition: Rich media (TB, 2xYT) vs. minimal media

    • Co-expression with chaperones (GroEL/ES, DnaK/J) to assist folding

  • Purification strategy:

    • Two-step chromatography approach:
      a) Affinity chromatography (IMAC, GST-affinity)
      b) Size exclusion or ion-exchange chromatography

    • Addition of FAD in buffers to ensure cofactor incorporation

    • Inclusion of reducing agents to maintain cysteine residues

  • Activity verification:

    • Spectrophotometric enzyme assays measuring NAD(P)H oxidation at 340nm

    • Verification of quinone reduction using specific substrates such as duroquinone (2,3,5,6-tetramethyl-p-benzoquinone)

These optimizations are critical for obtaining functionally active enzyme suitable for structural studies, kinetic analyses, and other biochemical characterizations.

What are the mechanistic differences in quinone reduction between chloroplastic and cytosolic NAD(P)H-quinone oxidoreductases?

The mechanistic differences between chloroplastic and cytosolic NAD(P)H-quinone oxidoreductases reflect their distinct evolutionary origins and cellular functions:

These differences reflect the specialized roles these enzymes play in their respective cellular compartments and organisms.

How can genome editing techniques be applied to study the in vivo function of NAD(P)H-quinone oxidoreductase in chickpea stress responses?

Advanced genome editing approaches offer powerful tools to investigate the physiological roles of NAD(P)H-quinone oxidoreductase in chickpea:

  • CRISPR/Cas9-mediated gene editing strategies:

    • Knockout approach: Complete gene disruption to assess loss-of-function phenotypes

    • Base editing: Introduction of specific amino acid changes to study structure-function relationships

    • Prime editing: Precise sequence modifications without double-strand breaks

    • Promoter editing: Modulation of expression levels rather than protein function

  • Experimental design for stress response studies:

    • Biotic stress: Challenge edited plants with Ascochyta rabiei and other pathogens, measuring disease progression metrics

    • Abiotic stress: Evaluate performance under drought, salinity, and high light conditions

    • Combined stresses: Test interactions between biotic and abiotic stressors

  • Phenotypic analysis approaches:

    • Physiological measurements: Photosynthetic parameters (quantum yield, NPQ, ETR)

    • Biochemical assays: ROS levels, antioxidant capacity, lipid peroxidation

    • Molecular analyses: Transcriptome (RNA-seq) and metabolome profiling

  • Technical considerations for chickpea transformation:

    • Agrobacterium-mediated transformation of embryo axes or shoot apical meristems

    • Use of tissue-specific or inducible promoters for temporal control

    • Integration of visual markers (GFP, RFP) for tracking expression

  • Validation approaches:

    • Complementation studies with the wild-type or variant genes

    • RNA-seq to identify compensatory mechanisms or affected pathways

    • Protein-protein interaction studies to identify functional partners

This approach has been productively applied in related legume research, as evidenced by studies using recombinant inbred lines (RILs) and genome-wide association studies (GWAS) to identify disease resistance loci in chickpea .

What are the technical challenges in resolving the crystal structure of plant chloroplastic NAD(P)H-quinone oxidoreductase complexes?

Determining the crystal structure of plant chloroplastic NAD(P)H-quinone oxidoreductase complexes presents several technical challenges that have limited structural studies:

  • Protein production challenges:

    • Difficulty expressing membrane-associated chloroplastic proteins

    • Maintaining stability of multi-subunit complexes during purification

    • Need for intact cofactor binding (FAD) for proper folding

    • Low yields from recombinant expression systems

  • Crystallization obstacles:

    • Large size and asymmetry of the complete NDH complex

    • Conformational heterogeneity affecting crystal packing

    • Detergent micelle interference with crystal contacts for membrane-associated regions

    • Multiple flexible regions that can hinder crystallization

  • Data collection and processing challenges:

    • Radiation damage during X-ray data collection

    • Potential twinning or disorder in crystals

    • Phase determination for novel structures without close homologs

    • Resolution limitations for large complexes

  • Alternative structural approaches:

    • Cryo-electron microscopy (cryo-EM) for entire complexes

    • Small-angle X-ray scattering (SAXS) for solution structure

    • Divide-and-conquer approach: Crystallize individual domains or subunits

    • Hybrid methods combining crystallographic and EM data

  • Strategies to overcome these challenges:

    • Heavy atom derivatives or selenomethionine incorporation for phasing

    • Surface entropy reduction to enhance crystallizability

    • Antibody-mediated crystallization to stabilize flexible regions

    • Lipidic cubic phase crystallization for membrane-associated regions

These technical challenges explain why structural information is more readily available for related enzymes from mammalian sources (human NQO1 at 1.7Å and mouse NQO1 at 2.8Å resolution) compared to plant chloroplastic complexes.

What are the optimal conditions for measuring NAD(P)H-quinone oxidoreductase enzyme activity in plant extracts?

Accurate assessment of NAD(P)H-quinone oxidoreductase activity in plant extracts requires careful optimization of assay conditions:

  • Sample preparation protocol:

    • Fresh tissue extraction in cold buffer (typically 50mM Tris-HCl or phosphate buffer, pH 7.4-7.6)

    • Addition of protease inhibitors (PMSF, leupeptin, pepstatin A)

    • Inclusion of reducing agents (DTT or β-mercaptoethanol) at 1-5mM

    • Gentle detergent (0.1% Triton X-100) for membrane-associated enzyme release

    • Centrifugation steps to remove debris (10,000-20,000×g, 15 minutes, 4°C)

  • Spectrophotometric assay conditions:

    • Monitoring NAD(P)H oxidation at 340nm (ε = 6,220 M⁻¹cm⁻¹)

    • Temperature control (25°C standard, 30°C for higher activity)

    • Buffer composition: 50mM Tris or phosphate buffer, pH 7.5

    • NAD(P)H concentration: 50-200μM (optimize for Km)

    • Quinone substrate: 10-100μM (duroquinone or physiological quinones)

    • Controls: Background oxidation rate without quinone substrate

  • Assay validation approaches:

    • Inhibitor studies using dicoumarol (1-10μM) to confirm specificity

    • Linearity assessment with varying protein concentrations

    • Substrate specificity testing with different quinones

    • Cofactor preference determination (NADH vs. NADPH)

  • Data analysis considerations:

    • Calculate specific activity in nmol min⁻¹ mg⁻¹ protein

    • Determine kinetic parameters (Km, Vmax) using Michaelis-Menten analysis

    • Compare activities across different tissues or treatments

    • Normalize to total protein content (Bradford or BCA assay)

  • Technical precautions:

    • Protect samples from light during preparation

    • Prepare fresh NAD(P)H solutions for each assay

    • Perform measurements in triplicate at minimum

    • Include appropriate enzyme standards for inter-assay comparison

These optimized conditions ensure reliable and reproducible measurement of NAD(P)H-quinone oxidoreductase activity in complex plant extracts.

How can transcriptional regulation of NAD(P)H-quinone oxidoreductase genes be analyzed in response to biotic stress?

Analyzing the transcriptional regulation of NAD(P)H-quinone oxidoreductase genes during biotic stress involves several complementary approaches:

  • Experimental design for stress treatments:

    • Pathogen inoculation protocols:

      • Fungal spore suspensions (e.g., A. rabiei at 1×10⁶ spores/ml)

      • Bacterial suspensions (OD600 = 0.1-0.5)

      • Mock inoculations as controls

    • Time-course sampling: Early (0-6h), intermediate (12-24h), and late (48-72h) timepoints

    • Multiple biological replicates (minimum n=3, ideally n=6)

  • RNA extraction and quality control:

    • Optimized protocols for plant tissues (e.g., Direct-zol RNA Miniprep)

    • DNase treatment to remove genomic DNA contamination

    • RNA integrity assessment (Bioanalyzer RIN > 7)

    • Quantification by spectrophotometry and fluorometry

  • Gene expression analysis methods:

    • Quantitative real-time PCR (qPCR):

      • Primer design for target NAD(P)H-quinone oxidoreductase genes

      • Reference gene selection (validated examples: HSP90, EF1α, GAPDH)

      • SYBR Green or TaqMan chemistry

      • Standard reaction conditions: 95°C for 3 min followed by 40 cycles of 95°C for 3s, 60°C for 20s

    • RNA-Seq for genome-wide expression profiling:

      • Library preparation protocols

      • Sequencing depth considerations (30M reads minimum)

      • Differential expression analysis pipelines

  • Data normalization and statistical analysis:

    • Relative quantification using 2^(-ΔΔCt) method

    • Statistical testing for significance (t-test, ANOVA)

    • Multiple testing correction (Benjamini-Hochberg)

    • Visualization approaches (heatmaps, expression plots)

  • Validation and functional correlation:

    • Protein level confirmation by Western blot

    • Correlation with enzyme activity measurements

    • Promoter analysis for stress-responsive elements

    • Comparison with other stress-responsive genes

Research by Garg et al. (2010) and others has established this methodological framework for analyzing gene expression in chickpea under stress conditions .

What techniques can be used to study protein-protein interactions involving NAD(P)H-quinone oxidoreductase in chloroplasts?

Investigating protein-protein interactions of chloroplastic NAD(P)H-quinone oxidoreductase requires specialized approaches due to the unique challenges of chloroplast proteins:

  • In vivo interaction methods:

    • Split-GFP/BiFC (Bimolecular Fluorescence Complementation):

      • Fusion of protein fragments to potential interacting partners

      • Visualization of reconstituted fluorescence in chloroplasts

      • Controls for specificity and subcellular localization

    • FRET/FLIM:

      • Fluorescent protein fusions (CFP-YFP pairs)

      • Energy transfer measurements in intact chloroplasts

      • Calculation of FRET efficiency and distance estimations

    • Co-immunoprecipitation from isolated chloroplasts:

      • Gentle solubilization with non-ionic detergents

      • Antibody selection (commercial or custom)

      • Western blot verification of co-precipitated proteins

  • In vitro interaction analyses:

    • Pull-down assays:

      • Recombinant protein production with affinity tags

      • Immobilization on appropriate matrices

      • Detection of bound partners by Western blot

    • Surface Plasmon Resonance (SPR):

      • Real-time binding kinetics measurement

      • Determination of association/dissociation constants

      • Multiple analyte concentrations for accurate fitting

    • Isothermal Titration Calorimetry (ITC):

      • Label-free binding thermodynamics

      • Stoichiometry determination

      • Entropy/enthalpy contribution analysis

  • Mass spectrometry-based approaches:

    • Cross-linking Mass Spectrometry (XL-MS):

      • Chemical crosslinking of protein complexes

      • Identification of crosslinked peptides

      • Spatial constraint determination for modeling

    • Co-IP coupled with LC-MS/MS:

      • Comprehensive identification of interaction partners

      • Label-free quantification for interaction strength

      • Comparison across conditions or treatments

  • Structural visualization methods:

    • Negative stain electron microscopy:

      • Rapid assessment of complex formation

      • Initial structural characterization

      • Sample quality evaluation

    • Cryo-electron microscopy:

      • High-resolution structural determination

      • Visualization of conformational states

      • Integration with crosslinking data

These techniques provide complementary information about the interaction landscape of NAD(P)H-quinone oxidoreductase within the chloroplast environment.

How can functional genomics approaches be applied to understand the role of NAD(P)H-quinone oxidoreductase in plant stress adaptation?

Functional genomics offers powerful strategies to elucidate the role of NAD(P)H-quinone oxidoreductase in plant stress adaptation:

  • Reverse genetics approaches:

    • CRISPR/Cas9 gene editing:

      • Complete knockout or specific domain mutations

      • Multiplexed editing for gene family members

      • Homology-directed repair for precise modifications

    • RNA interference (RNAi):

      • Construct design for specific gene silencing

      • Inducible or tissue-specific silencing systems

      • Assessment of knockdown efficiency by qPCR

    • TILLING (Targeting Induced Local Lesions IN Genomes):

      • Chemical mutagenesis followed by screening

      • Identification of point mutations in target genes

      • Phenotypic evaluation of mutant lines

  • Forward genetics strategies:

    • Genetic mapping of stress resistance traits:

      • Development of mapping populations (RILs, NILs)

      • Genotyping approaches (SNP arrays, genotyping-by-sequencing)

      • QTL identification and fine-mapping

    • Genome-wide association studies (GWAS):

      • Diverse germplasm collections

      • High-density SNP genotyping

      • Statistical models for trait associations

    • Suppressor/enhancer screens:

      • Identification of genetic modifiers

      • Second-site mutation analysis

      • Epistasis testing for pathway placement

  • Omics integration approaches:

    • Multi-omics experimental design:

      • Coordinated sampling for different omics analyses

      • Consistent stress treatments across experiments

      • Appropriate biological replication (n≥3)

    • Data integration strategies:

      • Correlation networks

      • Pathway enrichment analysis

      • Metabolic flux modeling

    • Visualization and interpretation tools:

      • Network analysis software

      • Pathway mapping resources

      • Comparative genomics platforms

  • Validation in diverse genetic backgrounds:

    • Transgenic complementation:

      • Wild-type and mutant gene variants

      • Assessment across stress conditions

      • Physiological and molecular phenotyping

    • Natural variation studies:

      • Allele mining in germplasm collections

      • Expression QTL (eQTL) analysis

      • Haplotype-phenotype associations

These approaches have been successfully implemented in chickpea research, as demonstrated by studies identifying genomic regions associated with Ascochyta blight resistance that could potentially involve NAD(P)H-quinone oxidoreductase or related enzymes in stress response pathways .

What are the promising research avenues for understanding the evolutionary significance of NAD(P)H-quinone oxidoreductases across plant species?

Several compelling research directions can advance our understanding of the evolutionary significance of NAD(P)H-quinone oxidoreductases:

  • Comparative genomics approaches:

    • Phylogenetic analysis across diverse plant lineages:

      • Gene family evolution from algae to angiosperms

      • Identification of gene duplication and diversification events

      • Selection pressure analysis (dN/dS ratios, Tajima's D test)

    • Synteny and microsynteny analysis:

      • Conservation of genomic context across species

      • Identification of ancestral genomic arrangements

      • Correlation with functional specialization

  • Structure-function relationship across evolutionary distance:

    • Comparative structural biology:

      • Modeling based on solved structures of homologs

      • Identification of conserved vs. variable domains

      • Substrate binding pocket evolution

    • Ancestral sequence reconstruction:

      • Resurrection of inferred ancestral enzymes

      • Biochemical characterization of ancestral proteins

      • Functional shifts during evolutionary history

  • Adaptation to ecological niches:

    • Correlation with photosynthetic strategies:

      • C3 vs. C4 vs. CAM metabolism

      • Sun vs. shade adaptation

      • Aquatic vs. terrestrial environments

    • Stress adaptation across climate gradients:

      • Cold vs. heat tolerance mechanisms

      • Drought adaptation strategies

      • Pathogen resistance evolution

  • Methodological approaches:

    • Heterologous expression of orthologs:

      • Biochemical characterization across species

      • Substrate specificity comparison

      • Kinetic parameter evolution

    • CRISPR-based interspecies gene replacements:

      • Functional complementation analysis

      • Fitness consequences under various conditions

      • Regulatory network compatibility testing

This evolutionary perspective would provide crucial insights into how NAD(P)H-quinone oxidoreductases have adapted to serve specific functions in different plant lineages and environmental contexts.

How might NAD(P)H-quinone oxidoreductase function in emerging models of chloroplast retrograde signaling?

NAD(P)H-quinone oxidoreductase may play significant roles in chloroplast retrograde signaling through several mechanisms:

  • Redox state signaling pathways:

    • NAD(P)H/NAD(P)+ ratio modulation:

      • Influence on cellular redox balance

      • Impact on redox-sensitive transcription factors

      • Integration with mitochondrial redox signaling

    • Quinone pool redox state:

      • Plastoquinone redox status as a retrograde signal

      • Coordination with photosynthetic electron transport

      • Influence on ROS production and signaling

  • Potential involvement in known retrograde signaling pathways:

    • MEcPP (methylerythritol cyclodiphosphate) pathway:

      • Connection to isoprenoid biosynthesis

      • Stress-induced signaling molecule production

      • Nuclear gene expression regulation

    • PAP (3'-phosphoadenosine 5'-phosphate) signaling:

      • Influence on sulfur metabolism

      • Drought and high light stress responses

      • Coordination with other stress response pathways

    • β-cyclocitral and other reactive electrophile species:

      • Production during oxidative stress

      • Transcriptional reprogramming functions

      • Connection to singlet oxygen signaling

  • Experimental approaches to investigate these connections:

    • Genetic manipulation strategies:

      • Knockout/knockdown of NDH complex components

      • Site-directed mutagenesis of key residues

      • Inducible expression systems for temporal control

    • Signaling molecule measurements:

      • Quantification of candidate retrograde signals

      • Correlation with enzyme activity under stress

      • Spatiotemporal dynamics analysis

    • Transcriptome and proteome profiling:

      • Nuclear gene expression changes

      • Protein abundance alterations

      • Post-translational modification patterns

  • Integration with photosynthetic regulation:

    • Non-photochemical quenching (NPQ) coordination:

      • Energy dissipation mechanisms

      • Photoprotective responses

      • State transition regulation

    • Cyclic electron flow modulation:

      • ATP/NADPH ratio adjustment

      • Photoprotection under stress conditions

      • Regulatory feedback mechanisms

This research direction would significantly advance our understanding of how chloroplasts communicate with the nucleus during development and stress responses.

How can current knowledge of NAD(P)H-quinone oxidoreductases inform strategies for improving crop stress tolerance?

The integration of current knowledge on NAD(P)H-quinone oxidoreductases into crop improvement strategies offers several promising approaches:

  • Targeted genetic engineering strategies:

    • Overexpression of native or enhanced variants:

      • Constitutive vs. stress-inducible promoters

      • Subcellular targeting optimization

      • Protein stability engineering

    • Promoter engineering for optimized expression patterns:

      • Tissue-specific expression

      • Developmental stage regulation

      • Stress-responsive elements

    • Precision editing of regulatory regions:

      • Enhancer modification for expression level adjustment

      • Transcription factor binding site optimization

      • Post-transcriptional regulation tuning

  • Marker-assisted selection approaches:

    • Identification of favorable natural alleles:

      • Haplotype block analysis in diverse germplasm

      • Association with stress tolerance phenotypes

      • Development of molecular markers

    • Integration with other stress resistance loci:

      • Pyramiding of complementary resistance mechanisms

      • Breaking of unfavorable linkages

      • Selection for optimal allele combinations

  • Physiological considerations for phenotyping:

    • Comprehensive stress response evaluation:

      • Multiple stress types (drought, heat, pathogens)

      • Combined stress scenarios

      • Realistic field conditions

    • Yield stability assessment:

      • Performance across environments

      • Stress timing and intensity variables

      • Reproductive stage resilience

  • Integration with other stress tolerance mechanisms:

    • Coordination with antioxidant systems:

      • Superoxide dismutase, catalase, peroxidases

      • Glutathione and ascorbate cycles

      • Non-enzymatic antioxidants

    • Hormone signaling network modulation:

      • Abscisic acid (ABA) responses

      • Salicylic acid (SA) pathways for biotic stress

      • Jasmonate (JA) signaling integration

This integrated approach recognizes that NAD(P)H-quinone oxidoreductases function within complex cellular networks, and effective crop improvement strategies must consider these broader interactions and potential trade-offs.

What are the key unanswered questions about Cicer arietinum NAD(P)H-quinone oxidoreductase that would significantly advance the field?

Several critical knowledge gaps regarding Cicer arietinum NAD(P)H-quinone oxidoreductase subunit 3 need to be addressed to significantly advance understanding:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.