Recombinant Cicer arietinum Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

The recombinant Cicer arietinum Photosystem II CP47 chlorophyll apoprotein (psbB) is a genetically engineered variant of the intrinsic transmembrane protein CP47, a critical component of Photosystem II (PSII) in higher plants. Encoded by the psbB gene, CP47 binds chlorophyll and facilitates light energy absorption, electron transfer, and structural stabilization within PSII’s reaction center . In chickpea (Cicer arietinum), this protein is essential for photosynthetic efficiency and PSII assembly .

Expression and Purification

The recombinant CP47 from Cicer arietinum is produced in Escherichia coli with the following specifications :

ParameterDetails
Expression HostEscherichia coli
TagN-terminal His tag
Purity>90% (SDS-PAGE verified)
Storage BufferTris-based buffer with 50% glycerol
ReconstitutionDeionized water (0.1–1.0 mg/mL) with 50% glycerol for stability

Functional Insights

  • Role in PSII Assembly: CP47 interacts with pre-assembled PSII reaction centers (RCs) and small subunits (PsbH, PsbL) to form the CP43-less PSII intermediate .

  • Chlorophyll Integration: Requires auxiliary proteins like PAM68 and FPB1 for chlorophyll insertion during co-translational membrane integration .

  • Thermotolerance: Upregulation of psbB under heat stress correlates with enhanced PSII stability in plants .

Mutational Studies

  • R448G Mutation: In cyanobacterial CP47, this mutation reduces photoautotrophic growth by 50% and PSII activity by 37%, highlighting conserved functional regions .

  • Psb27 Interaction: Structural studies reveal Psb27 binds CP47’s luminal surface, regulating PSII repair cycles .

Comparative Analysis with Orthologs

The Cicer arietinum CP47 shares structural and functional homology with other species, as shown below:

SpeciesCicer arietinum Draba nemorosa Spinacia oleracea
Amino Acid Length509508508
Molecular Weight~56 kDa~56 kDa~56 kDa
Expression SystemE. coliE. coliE. coli
Key Structural MotifE-loop (200 aa)E-loop (200 aa)E-loop (200 aa)

Applications and Future Directions

  • Biotechnological Use: Recombinant CP47 serves as a tool for studying PSII assembly and chlorophyll-protein interactions .

  • Agricultural Optimization: Insights into CP47’s role in stress responses could inform crop breeding for heat-tolerant chickpea varieties .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-509
Protein Length
full length protein
Species
Cicer arietinum (Chickpea) (Garbanzo)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWNITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLAGVGCFGFGAFHVTGLFGPGIWVSDPYGLTGRVQS VNPAWGVDGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHVSFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPSTKKPVVS
Uniprot No.

Target Background

Function
CP47 is a component of the core complex of photosystem II (PSII). It binds chlorophyll and plays a crucial role in catalyzing the primary light-induced photochemical processes of PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H₂O, generating O₂ and a proton gradient that is subsequently used for ATP formation.
Database Links

KEGG: cam:6797495

Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the role of CP47 apoprotein in Photosystem II, and how does it compare across plant species?

CP47 functions as one of the integral antenna complexes of the oxygen-evolving Photosystem II (PSII), responsible for efficient excitation energy transfer to the PSII reaction center. This protein-pigment complex contains approximately 16 chlorophyll molecules whose precise arrangement facilitates energy funneling toward the reaction center . CP47 is highly conserved across photosynthetic organisms, though species-specific variations exist.

How does chlorophyll binding affect the structure and stability of the CP47 apoprotein?

Quantum mechanics/molecular mechanics (QM/MM) studies have demonstrated that protein environment significantly modulates the excitation energies of chlorophylls in CP47, indicating that protein-pigment interactions are bidirectional - the protein structure affects chlorophyll properties, while chlorophyll binding influences protein stability and conformation .

What are the optimal expression systems for recombinant production of functional CP47 from Cicer arietinum?

Recombinant expression of membrane proteins like CP47 presents significant challenges due to their hydrophobic nature and requirement for cofactor (chlorophyll) binding. When expressing Cicer arietinum CP47, researchers must carefully select systems that can properly process this complex membrane protein.

Based on general approaches for photosynthetic proteins, several expression systems warrant consideration:

  • Cyanobacterial expression systems: Despite phylogenetic distance from plants, cyanobacteria possess the machinery for chlorophyll synthesis and membrane insertion, making them suitable hosts for functional CP47 expression.

  • Chlamydomonas reinhardtii chloroplast transformation: This green alga allows for chloroplast transformation and has been used successfully for expressing photosystem components with proper cofactor incorporation.

  • Plant-based transient expression: Systems using Nicotiana benthamiana can potentially provide the appropriate cellular environment for proper folding and cofactor assembly.

The key challenge remains coordinating apoprotein synthesis with chlorophyll availability. Research has shown that membrane engagement of nascent plastid-encoded chlorophyll apoproteins occurs shortly after the first transmembrane segment emerges from the ribosome, suggesting that expression systems must support co-translational membrane insertion .

How can researchers overcome challenges in maintaining protein stability during purification of recombinant CP47?

Purification of CP47 requires specialized approaches to maintain structural integrity throughout the process. Key methodological considerations include:

  • Detergent selection: Mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin are preferred for solubilization, as they better preserve native protein-pigment interactions compared to harsher ionic detergents.

  • Buffer optimization: Including glycerol (10-20%) and appropriate salt concentrations can enhance stability. Maintaining physiological pH (usually 6.5-7.5) is crucial.

  • Temperature control: All purification steps should be performed at 4°C or below to minimize protein degradation and pigment loss.

  • Light protection: Minimizing exposure to light prevents chlorophyll photooxidation and subsequent protein destabilization.

  • Rapid processing: Completing purification quickly reduces exposure to destabilizing conditions.

Research has demonstrated that chlorophyll binding is essential for CP47 stability, suggesting that supplementation with chlorophyll derivatives during purification might enhance protein stability . Additionally, incorporation of lipids that mimic the thylakoid membrane environment can help maintain the native conformation of the protein-pigment complex.

What quantum mechanical approaches are most effective for studying chlorophyll excitation in CP47?

Advanced quantum mechanical approaches have proven valuable for understanding the electronic properties of chlorophylls within CP47. Research indicates that time-dependent density functional theory (TD-DFT) with range-separated functionals provides accurate predictions of chlorophyll excitation energies and energy transfer pathways .

A multiscale quantum mechanics/molecular mechanics (QM/MM) approach utilizing full TD-DFT with modern range-separated functionals has been successfully employed to compute excitation energies of all CP47 chlorophylls in complete membrane-embedded photosystem II dimers . This methodology accurately quantifies the electrostatic effect of the protein environment on the site energies of CP47 chlorophylls, providing a high-level quantum chemical excitation profile .

Key findings from such studies include:

  • Identification of the most red-shifted chlorophylls (B3, followed by B1), which differs from earlier hypotheses .

  • Quantification of protein-induced shifts in absorption energies.

  • Elucidation of excitation energy transfer pathways within the CP47 complex.

These computational approaches complement experimental spectroscopic methods and provide atomic-level insights into the functional mechanisms of the CP47 complex.

How can researchers effectively analyze the membrane integration process of CP47 during synthesis?

Investigating the co-translational membrane integration of CP47 requires specialized techniques that can capture this dynamic process. Recent research has made significant progress in understanding this process, showing that membrane engagement occurs shortly after the first transmembrane segment emerges from the ribosome .

Effective methodological approaches include:

  • Ribosome profiling: This technique provides genome-wide information on ribosome positions and has been used to examine the synthesis and membrane targeting of chlorophyll-binding proteins . It can identify potential pause sites during translation that might coordinate with membrane insertion or chlorophyll binding.

  • In vivo and in organello pulse-labeling: These approaches have been used to suggest that the synthesis rate of chlorophyll-binding apoproteins increases upon shifting from dark to light, coinciding with chlorophyll synthesis onset .

  • Site-specific crosslinking: This technique can identify interactions between nascent CP47 and membrane translocase components during synthesis.

  • Fluorescence microscopy with translational reporters: By fusing fluorescent tags to CP47, researchers can visualize the localization process in real-time.

Research has identified an interaction between chlorophyll synthesis enzymes and the ALB3 protein translocase in the thylakoid membrane in cyanobacteria, providing a potential coordination mechanism between chlorophyll synthesis and CP47 membrane integration . These findings suggest a highly coordinated process that merits further investigation in plant systems like Cicer arietinum.

How do researchers assess the impact of specific mutations on CP47 function in recombinant systems?

Site-directed mutagenesis of recombinant CP47 provides valuable insights into structure-function relationships. Methodological approaches for functional assessment of CP47 mutants include:

  • Chlorophyll fluorescence analysis: Techniques such as pulse-amplitude modulation (PAM) fluorometry allow measurement of key photosynthetic parameters including quantum yield, electron transport rate, and non-photochemical quenching. Changes in these parameters in mutant variants can reveal functional implications of specific residues.

  • Oxygen evolution measurements: Direct measurement of oxygen production using Clark-type electrodes provides quantitative assessment of PSII function in reconstituted systems containing mutant CP47.

  • Time-resolved spectroscopy: These techniques can detect alterations in excitation energy transfer kinetics resulting from mutations in chlorophyll-binding sites.

  • Low-temperature (77K) fluorescence spectroscopy: This approach can identify shifts in chlorophyll organization and energy coupling between pigments in the mutant protein.

  • Protein-pigment reconstitution assays: In vitro reconstitution of CP47 with chlorophyll provides a means to assess how mutations affect pigment binding affinity and specificity.

When interpreting results, researchers must consider that mutations may have multifaceted effects, including altered protein stability, chlorophyll binding, protein-protein interactions, and membrane integration.

What spectroscopic techniques best characterize energy transfer within the CP47 complex?

Understanding energy transfer pathways within CP47 requires sophisticated spectroscopic approaches that can detect ultrafast processes. Effective methodological approaches include:

  • Two-dimensional electronic spectroscopy (2DES): This technique provides detailed maps of electronic coupling between pigments and can resolve energy transfer pathways with femtosecond time resolution.

  • Transient absorption spectroscopy: By monitoring absorption changes following excitation, researchers can track energy migration through the chlorophyll network with high temporal resolution.

  • Fluorescence lifetime measurements: These reveal the kinetics of excited state decay and energy transfer between chlorophylls within the complex.

  • Circular dichroism spectroscopy: This technique provides information about pigment-pigment interactions and the chiral environment of bound chlorophylls.

  • Single-molecule spectroscopy: This approach can reveal heterogeneity in energy transfer pathways that might be obscured in ensemble measurements.

When combined with structural data and quantum mechanical calculations, these spectroscopic approaches provide comprehensive insights into the functional architecture of CP47. Recent research using multiscale QM/MM approaches has identified the most red-shifted chlorophylls in CP47 (B3 followed by B1), which likely serve as energy funnels within the complex . This ranking differs from previous hypotheses and provides new perspectives on energy transfer pathways.

How can recombinant CP47 studies contribute to improving photosynthetic efficiency in crops?

Studies of recombinant CP47 from Cicer arietinum and other crop species provide fundamental insights that could inform strategies for photosynthetic improvement. Methodological approaches with practical applications include:

  • Comparative analysis of CP47 variants: Studying natural variation in CP47 across cultivars with differing photosynthetic efficiencies can identify beneficial sequence variations that could be introduced into crop improvement programs.

  • Engineering optimized energy transfer: Understanding the quantum mechanical basis of excitation energy transfer in CP47 could guide efforts to optimize light harvesting by modifying chlorophyll organization or protein environment.

  • Stress resistance improvements: Characterizing how CP47 structure and function change under environmental stresses could inform the development of more resilient photosynthetic machinery in crops.

  • Synthetic biology approaches: Knowledge from recombinant CP47 studies can guide the design of synthetic antenna systems with enhanced light-harvesting capabilities or expanded spectral ranges.

Research has demonstrated that protein environment significantly modulates chlorophyll excitation properties , suggesting that even subtle modifications to CP47 structure could have meaningful impacts on photosynthetic performance. Future work should focus on translating fundamental insights from recombinant protein studies to practical applications in crop improvement.

What are the current contradictions in our understanding of chlorophyll-protein assembly in CP47, and how might they be resolved?

Several contradictions exist in our understanding of chlorophyll-protein assembly in CP47 and other photosystem components. Resolving these contradictions requires innovative experimental approaches:

  • Translation activation versus protein stabilization: Some studies suggest chlorophyll activates translation of photosystem components, while others indicate it primarily stabilizes the proteins post-translationally . This contradiction might be resolved through:

    • Ribosome profiling experiments comparing translation rates with and without chlorophyll availability

    • Development of systems that allow temporal control of chlorophyll synthesis independent of other factors

    • Pulse-chase experiments with improved ability to distinguish synthesis from degradation

  • Ribosome pausing mechanisms: While specific ribosome pausing sites were identified on photosystem mRNAs and suggested to enable chlorophyll binding, pausing was not detectably altered between dark-grown plants and briefly illuminated plants . This contradiction could be addressed through:

    • Higher-resolution ribosome profiling

    • Direct visualization of nascent chain elongation using fluorescence techniques

    • Correlating pausing with chlorophyll binding in real-time

  • Coordination mechanisms: The relationship between membrane integration and chlorophyll binding remains unclear. Evidence suggests an interaction between chlorophyll synthesis enzymes and membrane translocases in cyanobacteria , but the mechanism in plants requires clarification through:

    • Proximity labeling techniques to identify protein interactions during assembly

    • Cryo-electron microscopy of assembly intermediates

    • Synthetic biology approaches that artificially control the timing of these processes

The technical challenges in studying these rapid, co-translational processes have contributed to contradictory findings. Future research employing cutting-edge techniques with higher temporal and spatial resolution will be essential for resolving these contradictions and developing a comprehensive model of CP47 assembly.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.