Recombinant Citrobacter koseri ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Citrobacter koseri ATP Synthase Subunit a (atpB)

Recombinant Citrobacter koseri ATP synthase subunit a (atpB) is a protein component of the ATP synthase enzyme complex found in the bacterial species Citrobacter koseri. This protein is typically expressed recombinantly in expression systems such as Escherichia coli for research and developmental purposes. The commercially available recombinant form of this protein consists of the full-length sequence (amino acids 1-271) and often includes an N-terminal histidine tag to facilitate purification and detection . As a key component of bacterial energy metabolism, this protein has emerged as an important subject of study in microbiology, biochemistry, and pharmaceutical research.

Citrobacter koseri itself is a gram-negative bacterial pathogen that has been implicated in various infections, particularly in immunocompromised individuals and neonates. This bacterium is known to cause urinary tract infections, bloodstream infections, and in severe cases, meningitis and brain abscesses . With the rising concern of antibiotic resistance among bacterial pathogens including C. koseri, research into essential bacterial proteins such as ATP synthase subunits has gained significant momentum as potential targets for novel therapeutic interventions .

Physical and Chemical Properties

The following table summarizes key physical and chemical properties of recombinant C. koseri ATP synthase subunit a (atpB):

PropertySpecification
Length271 amino acids (full length)
TagsN-terminal His tag
SourceExpressed in E. coli
FormLyophilized powder
Purity>90% as determined by SDS-PAGE
UniProt IDA8ACP4
Gene NameatpB
SynonymsATP synthase F0 sector subunit a; F-ATPase subunit 6

Role in Energy Metabolism

ATP synthase is a critical enzyme complex found in the cytoplasmic membrane of prokaryotic cells, including C. koseri. This complex plays a fundamental role in cellular energy production by catalyzing the synthesis of adenosine triphosphate (ATP), which serves as the primary energy currency for cellular processes . The ATP synthase complex utilizes the proton gradient across the cytoplasmic membrane to drive the synthesis of ATP from adenosine diphosphate (ADP) and inorganic phosphate.

The subunit a (atpB) specifically contributes to the formation of the membrane-embedded F0 portion of the ATP synthase complex. This subunit contains the proton channel that allows protons to flow through the membrane, thereby generating the rotational force necessary for ATP synthesis. The subunit's structure is highly specialized, featuring transmembrane regions that span the bacterial cell membrane .

Significance in Bacterial Survival and Pathogenicity

The ATP synthase complex is essential for bacterial survival as it provides the energy required for various cellular processes, including growth, reproduction, and virulence factor production. In C. koseri, ATP synthase activity is particularly crucial given this pathogen's ability to cause invasive infections and survive in diverse environments within the human host .

Research has indicated that disruption of ATP synthase function can significantly impair bacterial viability, making this enzyme complex an attractive target for antimicrobial development. This is especially relevant in the context of emerging antibiotic resistance among C. koseri strains, which complicates conventional treatment approaches .

Recombinant Expression and Purification

Recombinant C. koseri ATP synthase subunit a (atpB) is typically produced using bacterial expression systems, with E. coli being the predominant host organism. The protein is expressed with an N-terminal histidine tag to facilitate purification through nickel affinity chromatography . Following expression and purification, the protein is typically lyophilized to enhance stability during storage and transportation.

The production process involves the following general steps:

  1. Cloning of the atpB gene into an appropriate expression vector

  2. Transformation of the construct into competent E. coli cells

  3. Induction of protein expression

  4. Cell lysis and protein extraction

  5. Affinity purification using the His-tag

  6. Quality control analysis, including SDS-PAGE to confirm purity

  7. Lyophilization and packaging

As a Target for Antimicrobial Development

One of the most significant research applications of recombinant C. koseri ATP synthase subunit a (atpB) lies in its potential as a target for novel antimicrobial agents. With the increasing prevalence of antibiotic-resistant C. koseri strains, there is an urgent need for alternative therapeutic approaches that target essential bacterial processes .

Recent computational studies have identified potential inhibitors of C. koseri ATP synthase through various drug design approaches. In one notable study, researchers utilized Computer-Aided Drug Design methodologies to identify compounds that could potentially inhibit the function of C. koseri ATP synthase. The study employed ligand-based pharmacophore modeling using the chemical features of ampicillin, followed by virtual screening across multiple databases .

The most promising inhibitor candidates identified through this approach exhibited binding affinities ranging from -10.021 to -8.452 kcal/mol. Four compounds in particular—PubChem-25230613, PubChem-74936833, CHEMBL263035, and PubChem-44208924—demonstrated favorable ADMET (Absorption, Distribution, Metabolism, Excretion, and Toxicity) characteristics and stable binding modes when subjected to molecular dynamics simulation studies .

As a Biomarker for C. koseri Identification

The species-specific nature of ATP synthase subunits has potential applications in the development of diagnostic tools for C. koseri identification. While not explicitly mentioned in the available search results, the unique sequence characteristics of C. koseri ATP synthase subunit a could potentially be exploited for the development of molecular diagnostic assays specific to this pathogen.

This application is particularly relevant in the context of clinical microbiology, where rapid and accurate identification of infectious agents is crucial for appropriate treatment decisions. The development of species-specific detection methods could facilitate more targeted antimicrobial therapy, potentially reducing the overuse of broad-spectrum antibiotics.

Computational Identification of Potential Inhibitors

A recent study published in 2024 employed computational approaches to identify potential inhibitors of C. koseri ATP synthase . The researchers utilized a combination of methods, including:

  1. Prediction of the 3D structure of C. koseri ATP synthase using SWISS-MODEL

  2. Development of a ligand-based pharmacophore model using chemical features of ampicillin

  3. Virtual screening across nine databases, which yielded 2043 potential hits

  4. Molecular docking to the ATP synthase active site using the standard precision mode of the glide tool

The study identified ten compounds with promising binding affinities, which were selected for further investigation. The binding affinities ranged from -10.021 to -8.452 kcal/mol, indicating strong potential for inhibitory activity. The top four compounds demonstrated favorable ADMET characteristics and stable binding modes, as confirmed through molecular dynamics simulation studies .

This research represents a significant step toward the development of novel therapeutics targeting C. koseri ATP synthase and highlights the potential of rational drug design approaches in addressing the challenge of antibiotic resistance.

Relevance in the Context of Pathogenicity

While the ATP synthase complex primarily functions in energy metabolism, research into C. koseri has also revealed insights into the potential relationship between energy production and pathogenicity. Comparative genomic analysis of Citrobacter species has identified various virulence factors and resistance genes that contribute to the pathogenic potential of these bacteria .

Although not directly related to ATP synthase, these studies provide context for understanding how essential metabolic processes, including ATP synthesis, may intersect with virulence mechanisms. Future research may explore potential connections between ATP synthase function and the expression of virulence factors in C. koseri.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your needs when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; CKO_00078; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Target Names
atpB
Target Protein Sequence
MASENMTPQDYIGHHLNNLQLDLRTFSLVDPHNPPATFWTLNIDSMFFSVVLGLLFLLMF RSVAKKATSGVPGKFQTAIELVIGFVHGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDL LPIDLLPYIGEHIFGLPALRVVPSADVNITLSMALGVFILILFYSIKMKGIGGFTKELTL QPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVP WAIFHILIITLQAFIFMGLTIVYLSMASEEH
Uniprot No.

Target Background

Function
As a key component of the proton channel, ATP synthase subunit a (atpB) plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How can I express and purify recombinant C. koseri ATP synthase subunit a?

For expression and purification of recombinant C. koseri ATP synthase subunit a, the following methodological approach is recommended:

  • Gene cloning: Amplify the atpB gene from C. koseri genomic DNA using PCR with high-fidelity polymerase and sequence-specific primers.

  • Vector construction: Clone the amplified gene into an expression vector containing a suitable tag (His-tag is commonly used for membrane proteins) for purification.

  • Expression system: Transform the construct into an appropriate E. coli strain optimized for membrane protein expression (e.g., C41(DE3) or C43(DE3)).

  • Culture conditions: Grow at lower temperatures (16-25°C) after induction to enhance proper folding.

  • Membrane isolation: Disrupt cells via sonication or French press, followed by differential centrifugation to isolate membrane fractions.

  • Solubilization: Use mild detergents (e.g., n-dodecyl-β-D-maltoside or digitonin) to extract the membrane protein.

  • Purification: Employ affinity chromatography using the tag, followed by size exclusion chromatography for higher purity.

What are the common challenges when working with recombinant C. koseri atpB?

Working with recombinant C. koseri atpB presents several methodological challenges:

  • Membrane protein solubility: As a membrane-embedded protein, atpB tends to form inclusion bodies or aggregate when overexpressed.

  • Protein misfolding: The hydrophobic nature of membrane proteins often leads to improper folding in recombinant expression systems.

  • Low yield: Membrane proteins typically express at lower levels compared to soluble proteins.

  • Functional assessment: Traditional enzymatic assays may be challenging as the protein functions as part of a multi-subunit complex.

  • Structural integrity: Maintaining the native conformation during purification requires careful selection of detergents and buffer conditions.

To address these challenges, consider using specialized expression hosts, fusion partners that enhance solubility, lower induction temperatures, and optimized detergent screens for purification.

How does C. koseri ATP synthase compare to other bacterial ATP synthases?

While C. koseri ATP synthase shares fundamental structural and functional properties with other bacterial ATP synthases, its specific characteristics make it worthy of focused research:

The C. koseri ATP synthase has been studied less extensively than its E. coli counterpart, making it a valuable research target, particularly in the context of opportunistic infections in immunocompromised patients .

What are the current approaches for targeting C. koseri ATP synthase for antimicrobial development?

Research on C. koseri ATP synthase as an antimicrobial target has employed several sophisticated approaches:

  • Structure-based drug design: Using the predicted 3D structure of C. koseri ATP synthase from SWISS-MODEL and AlphaFold models to identify potential binding pockets for inhibitor design .

  • Ligand-based pharmacophore modeling: Developing pharmacophore models based on known ATP synthase inhibitors such as ampicillin to identify chemical features critical for binding .

  • Virtual screening and molecular docking: Large-scale screening of compound libraries against the ATP synthase structure, with the top compounds selected based on binding affinities. Recent research identified compounds with binding affinities ranging from -10.021 to -8.452 kcal/mol .

  • ADMET profiling: Evaluating pharmacokinetic properties of potential inhibitors to prioritize compounds with favorable drug-like characteristics.

  • Molecular dynamics simulations: Assessing the stability of protein-ligand complexes over time to confirm binding modes and identify stable interactions.

The most promising recent candidates include PubChem-25230613, PubChem-74936833, CHEMBL263035, and PubChem-44208924, which demonstrated favorable binding characteristics and ADMET profiles in computational studies .

How can I assess the functional integrity of recombinant C. koseri atpB in vitro?

Evaluating the functional integrity of recombinant C. koseri atpB requires specialized approaches:

  • Reconstitution assays: Incorporate purified atpB into liposomes or nanodiscs along with other ATP synthase subunits to reconstitute functional complexes.

  • Proton translocation measurements: Use pH-sensitive fluorescent dyes (e.g., ACMA or pyranine) to monitor proton movement across membranes containing reconstituted atpB.

  • ATP synthesis activity: Measure ATP production in reconstituted systems using luciferase-based assays when a proton gradient is applied.

  • Binding studies: Assess interaction with known ATP synthase inhibitors using techniques such as isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR).

  • Structural integrity verification: Employ circular dichroism (CD) spectroscopy to confirm secondary structure content and thermal stability.

  • Site-directed mutagenesis: Introduce mutations in conserved residues predicted to be essential for function and assess the impact on activity.

What role does atpB play in C. koseri virulence and opportunistic infections?

The role of ATP synthase subunit a in C. koseri virulence is a complex area of research with several important considerations:

  • Energy provision for virulence: ATP synthase supplies the energy required for numerous virulence mechanisms, including type III secretion systems, flagellar motility, and toxin production.

  • Adaptation to host environments: ATP synthase enables metabolic flexibility, allowing C. koseri to adapt to varying nutrient and oxygen conditions within the host.

  • Biofilm formation: ATP production supports the energy-intensive process of biofilm development, which enhances persistence in hostile environments.

  • Connection to immunocompromised hosts: C. koseri predominantly causes infections in individuals with compromised immunity or significant comorbidities, suggesting that under normal immune surveillance, the organism's virulence mechanisms (including ATP-dependent processes) are controlled .

  • Link to underlying pathologies: There is evidence that C. koseri infections may be associated with underlying conditions such as malignancy, as demonstrated in a case where C. koseri pneumonia led to the discovery of pulmonary adenocarcinoma .

Recent studies have emphasized the importance of ATP synthesis in opportunistic pathogens like C. koseri, particularly in the context of emerging antibiotic resistance .

How can I design experiments to investigate atpB's role in antibiotic resistance mechanisms in C. koseri?

To investigate the role of ATP synthase subunit a in antibiotic resistance, consider the following experimental design approaches:

  • Gene knockout/knockdown studies:

    • Create atpB deletion or conditional expression mutants

    • Compare minimum inhibitory concentrations (MICs) of various antibiotics between wild-type and mutant strains

    • Assess growth rates and fitness costs of mutations

  • Overexpression analysis:

    • Express wild-type or mutated atpB variants in C. koseri

    • Evaluate changes in antibiotic susceptibility patterns

    • Measure energy production capacity in these strains

  • Combination therapy assessment:

    • Test ATP synthase inhibitors in combination with conventional antibiotics

    • Determine synergistic, additive, or antagonistic effects using checkerboard assays

    • Calculate fractional inhibitory concentration indices (FICI)

  • Resistance development monitoring:

    • Conduct serial passage experiments in sub-inhibitory concentrations of ATP synthase inhibitors

    • Sequence atpB and other ATP synthase genes to identify emerging mutations

    • Characterize cross-resistance patterns to different antibiotic classes

  • Molecular basis investigation:

    • Identify blaKPC-containing C. koseri strains, which have been reported in previous research

    • Investigate potential metabolic adaptations in these resistant strains

    • Assess whether changes in ATP synthase expression or activity correlate with resistance profiles

What are the latest computational approaches for studying atpB structure-function relationships?

Advanced computational methods have become essential for studying structure-function relationships in proteins like C. koseri atpB:

  • Homology modeling and ab initio structure prediction:

    • SWISS-MODEL has been used with E. coli ATP synthase (PDB ID: 6OQR) as a template

    • AlphaFold has provided ab initio models of C. koseri ATP synthase

    • Structure validation using tools like VERIFY, ERRAT, and MolProbity ensures model quality

  • Molecular dynamics simulations:

    • All-atom simulations to analyze protein stability and conformational changes

    • Assessment of protein-membrane interactions in lipid bilayer environments

    • Analysis of proton translocation pathways through the membrane domain

  • Quantum mechanics/molecular mechanics (QM/MM):

    • Hybrid methods to study proton transfer mechanisms with quantum-level accuracy

    • Investigation of catalytic residues involved in proton translocation

  • Machine learning approaches:

    • Prediction of functional sites based on sequence conservation and structural features

    • Identification of potential drug binding sites through deep learning algorithms

  • Virtual screening and docking:

    • Large-scale screening of compound libraries against predicted binding pockets

    • Recent studies screened 2043 compounds, with the top hits showing binding affinities between -10.021 and -8.452 kcal/mol

How can I design a recombinant expression system optimized specifically for C. koseri atpB?

Designing an optimized expression system for C. koseri atpB requires careful consideration of multiple factors:

  • Codon optimization:

    • Analyze the codon usage bias in the target expression host

    • Optimize the atpB gene sequence to match the preferred codons without altering the amino acid sequence

    • Consider GC content and potential secondary structures in mRNA

  • Expression vector selection:

    • Choose vectors with tunable promoters (e.g., rhamnose or tetracycline-inducible) for precise control

    • Consider fusion partners that enhance membrane protein expression (e.g., Mistic, SUMO, or GFP)

    • Incorporate affinity tags that minimally interfere with protein function

  • Host strain engineering:

    • Select strains designed for membrane protein expression (C41/C43(DE3), Lemo21(DE3))

    • Consider knockout strains lacking proteases that degrade membrane proteins

    • Evaluate co-expression of chaperones (GroEL/GroES, DnaK/DnaJ) to assist folding

  • Culture conditions optimization:

    • Test expression at various temperatures (16-30°C)

    • Evaluate different induction strategies (OD₆₀₀ at induction, inducer concentration)

    • Consider specialized media formulations to enhance membrane protein expression

  • High-throughput screening:

    • Design a parallel expression screening approach with different combinations of vectors, hosts, and conditions

    • Use GFP fusion to rapidly assess proper folding and membrane insertion

    • Implement small-scale purification protocols to identify optimal conditions before scaling up

What techniques are most effective for studying the interaction between atpB and potential inhibitor compounds?

To effectively study interactions between C. koseri atpB and potential inhibitors, employ these methodological approaches:

  • Biophysical techniques:

    • Isothermal Titration Calorimetry (ITC): Provides binding constants, stoichiometry, and thermodynamic parameters

    • Surface Plasmon Resonance (SPR): Enables real-time monitoring of binding kinetics

    • Microscale Thermophoresis (MST): Detects interactions with minimal protein consumption

    • Thermal Shift Assays: Monitors protein stabilization upon inhibitor binding

  • Structural methods:

    • X-ray crystallography of atpB-inhibitor complexes (challenging but highly informative)

    • Cryo-electron microscopy (cryo-EM) of ATP synthase complexes with bound inhibitors

    • NMR spectroscopy for analyzing inhibitor binding sites and conformational changes

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions protected upon inhibitor binding

  • Functional assays:

    • ATP synthesis inhibition assays using reconstituted systems

    • Proton translocation measurements in the presence of inhibitors

    • Growth inhibition assays with C. koseri cultures

  • Computational approaches:

    • Molecular docking to predict binding modes

    • Molecular dynamics simulations to assess stability of protein-inhibitor complexes

    • Free energy calculations to estimate binding affinities

Recent computational screening identified compounds with binding affinities ranging from -10.021 to -8.452 kcal/mol, with the top four compounds (PubChem-25230613, PubChem-74936833, CHEMBL263035, PubChem-44208924) showing promising ADMET profiles and stable binding interactions .

How should I interpret discrepancies between computational models and experimental data for C. koseri atpB?

When confronted with discrepancies between computational predictions and experimental results for C. koseri atpB, consider these analytical approaches:

  • Model validation and refinement:

    • Reassess the quality of the computational model using multiple validation metrics

    • Consider the limitations of template-based modeling, especially if sequence identity with the template is <30%

    • Refine models using experimental constraints from techniques like cross-linking or HDX-MS

  • Experimental limitations analysis:

    • Evaluate whether the recombinant protein maintains native folding and function

    • Consider if detergents or reconstitution systems might alter protein behavior

    • Assess the sensitivity and specificity of experimental assays

  • Contextual differences:

    • Computational models often represent static structures, while proteins are dynamic

    • Environmental factors (pH, ionic strength, membrane composition) may differ between computational assumptions and experimental conditions

    • Interactions with other ATP synthase subunits may influence atpB behavior

  • Systematic comparison approach:

    • Create a detailed comparison table highlighting specific discrepancies

    • Prioritize investigation of critical functional residues or regions

    • Design targeted experiments to specifically address the discrepancies

  • Integrated analysis:

    • Combine multiple computational approaches (homology modeling, molecular dynamics, QM/MM)

    • Triangulate with diverse experimental techniques

    • Consider ensemble-based approaches rather than single static models

What statistical approaches are appropriate for analyzing structure-activity relationships of potential atpB inhibitors?

For robust structure-activity relationship (SAR) analysis of potential C. koseri atpB inhibitors, these statistical approaches are recommended:

  • Correlation analysis:

    • Pearson or Spearman correlation between structural descriptors and biological activity

    • Multiple linear regression (MLR) to identify key structural features influencing activity

    • Principal component analysis (PCA) to reduce dimensionality and identify patterns

  • Quantitative Structure-Activity Relationship (QSAR) modeling:

    • Partial least squares (PLS) regression for handling many potentially correlated variables

    • Support vector machines (SVM) for classification of active versus inactive compounds

    • Random forest algorithms for handling complex, non-linear relationships

  • Pharmacophore modeling:

    • Statistical validation of pharmacophore hypotheses using ROC curves and enrichment factors

    • Bootstrap analysis to assess model robustness

    • Cross-validation to evaluate predictive performance

  • Machine learning approaches:

    • Neural networks for identifying complex patterns in structure-activity data

    • Bayesian models for activity prediction with uncertainty quantification

    • Transfer learning when working with limited datasets

  • Model validation:

    • k-fold cross-validation to assess generalizability

    • External validation sets to evaluate predictive power

    • Y-scrambling to detect chance correlations

Recent computational studies applied these approaches to identify potential ATP synthase inhibitors with binding affinities ranging from -10.021 to -8.452 kcal/mol, demonstrating the utility of statistical methods in this research area .

What are emerging approaches for targeting ATP synthase in antibiotic-resistant C. koseri strains?

Several innovative approaches show promise for targeting ATP synthase in antibiotic-resistant C. koseri:

  • Allosteric inhibitor development:

    • Targeting non-conserved allosteric sites specific to bacterial ATP synthases

    • Designing inhibitors that selectively disrupt conformational changes rather than directly blocking the active site

  • Combination therapies:

    • Pairing ATP synthase inhibitors with conventional antibiotics to overcome resistance

    • Developing dual-action compounds that simultaneously target ATP synthase and other essential processes

  • Immunomodulatory approaches:

    • Designing agents that both inhibit ATP synthase and enhance host immune response

    • Developing antibody-drug conjugates targeting bacterial ATP synthase

  • Nanoparticle delivery systems:

    • Engineering nanoparticles for targeted delivery of ATP synthase inhibitors to infection sites

    • Developing pH-responsive nanocarriers that release inhibitors in the acidic microenvironment of bacterial infections

  • CRISPR-Cas antimicrobials:

    • Designing CRISPR-Cas systems targeting atpB genes in resistant strains

    • Developing RNA-guided nucleases specific for resistance-associated mutations

The emergence of blaKPC-containing C. koseri strains highlights the urgent need for new antimicrobial approaches that can overcome existing resistance mechanisms .

How might research on C. koseri atpB contribute to our understanding of pathogenesis in immunocompromised hosts?

Research on C. koseri ATP synthase subunit a has significant implications for understanding opportunistic infections in immunocompromised hosts:

  • Energy metabolism-virulence connections:

    • Investigating how ATP production supports various virulence mechanisms

    • Understanding metabolic adaptations that occur during transition from commensal to pathogen

  • Host-pathogen interactions:

    • Exploring how ATP synthase activity influences bacterial persistence in immunocompromised environments

    • Investigating potential interactions between bacterial ATP synthase and host immune components

  • Biomarker development:

    • Assessing whether ATP synthase components could serve as biomarkers for early detection of infection

    • Investigating atpB expression patterns during different stages of infection

  • Personalized treatment approaches:

    • Developing therapeutic strategies targeting ATP synthase that account for specific immune deficiencies

    • Investigating how underlying conditions (such as malignancy) influence C. koseri infections and ATP synthase function

  • Model system development:

    • Establishing C. koseri as a model organism for studying opportunistic infections

    • Creating experimental systems that mimic the immune environment of compromised hosts

The reported association between C. koseri pneumonia and underlying pulmonary adenocarcinoma suggests complex interactions between host pathology and bacterial opportunism that warrant further investigation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.