Recombinant Citrobacter koseri Bifunctional protein aas (aas)

Shipped with Ice Packs
In Stock

Description

Expression and Production

The protein is produced via heterologous expression systems, with two primary methods documented:

SystemHostKey Features
E. coli-basedE. coliHigh yield, cost-effective; includes His-tag
Cell-free expressionIn vitroTransmembrane protein production; glycerol-stabilized

Post-Production Handling:

  • Storage: Lyophilized powder stored at -20°C/-80°C. Reconstituted aliquots (0.1–1.0 mg/mL) are stable at 4°C for ≤1 week .

  • Buffer: Tris/PBS-based with 6% trehalose (pH 8.0) to prevent aggregation .

Functional Mechanism

The Aas protein operates in two sequential enzymatic steps:

  1. Acyl-ACP Synthesis:

    Fatty acid+ACP+ATPAcyl-ACP+AMP+PPi\text{Fatty acid} + \text{ACP} + \text{ATP} \rightarrow \text{Acyl-ACP} + \text{AMP} + \text{PP}_i
  2. Lipid Acylation:

    Acyl-ACP+2-acyl-GPEPhosphatidylethanolamine+ACP\text{Acyl-ACP} + \text{2-acyl-GPE} \rightarrow \text{Phosphatidylethanolamine} + \text{ACP}

This dual activity is critical for maintaining membrane phospholipid homeostasis, particularly in bacterial lipid remodeling .

Research Applications

While not directly implicated in clinical pathogenicity (unlike other Citrobacter spp. virulence factors ), the Aas protein serves as a model for studying:

  • Lipid Metabolism: Role in phospholipid biosynthesis and membrane dynamics.

  • Enzyme Kinetics: ATP-dependent acyltransferase activity and substrate specificity.

  • Structural Biology: Crystallization studies to elucidate domain interactions.

Comparative Data on Expression Systems

ParameterE. coli System Cell-Free System
YieldHighModerate (transmembrane focus)
Purity≥90%≥85%
Glycerol Content50% (recommended)Included in buffer
CostLowerHigher

Clinical and Pathogenic Relevance

Though C. koseri strains exhibit antibiotic resistance mechanisms (e.g., β-lactamase cko , quinolone-modifying enzymes ), the Aas protein is not linked to virulence. Its primary relevance lies in basic biochemical research, particularly in understanding bacterial lipid synthesis and acyl-ACP-dependent pathways.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aas; CKO_04208; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Long-chain-fatty-acid--[acyl-carrier-protein] ligase]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-719
Protein Length
full length protein
Species
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Target Names
aas
Target Protein Sequence
MLFGFFRNLFRVLYRVRVTGDARALQGERILITPNHVSFIDGILLALFLPVRPVFAVYSS ISQQWYMRWLKSLIDFVPLDPTKPMAIKHLVRLVEQGRPVVIFPEGRISVSGSLMKIYDG AGFVAAKSGATVVPVRIEGAELTHFSRLKGLVKQRFFPRIHLHILPPTHLPMPEAPRARE RRKLAGEMLHQIMMEARMAVRPRETLYESLLAAQYRYGAGKNCVEDINFTPDTYRKLLTK TLFVGRILEKYSAQGENIGLMLPNAAISAAVIFGAVSRGRIPAMMNYTAGVKGLTSAITA AEIKTVFTSRQFLEKGKLWHLPEQLTQVRWIYLEDLKADVTLADKLWIFAHLLMPRLAQV KQRPEEAAMILFTSGSEGHPKGVVHSHKSLLANVEQIKTIADFTANDRFMSALPLFHSFG LTVGLLTPLLTGAEVFLYPSPLHYRIVPELVYDRNCTVLFGTSTFLGNYARFANPYDFYR LRYVVAGAEKLQDSTRQLWQDKFGLRVLEGYGVTECAPVVSINVPMAAKPGTVGRILPGM DARLLAVPGIDDGGRLQLKGPNIMNGYLRVEKPGVLEAPAAENALGDVEQGWYDTGDIVR FDENGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKMHATAIKSDASKGEALVLFT TDGELTRESLLQYARTHGIPELAVPRDIRYLKQLPLLGSGKPDFVTLKSWVDEPEKQHA
Uniprot No.

Target Background

Function

This bifunctional protein plays a crucial role in lysophospholipid acylation. Specifically, it catalyzes the transfer of fatty acids to the 1-position of lysophospholipids via an enzyme-bound acyl-ACP intermediate. This process requires ATP and magnesium ions. Its physiological function is the regeneration of phosphatidylethanolamine from 2-acyl-glycero-3-phosphoethanolamine (2-acyl-GPE), a product of transacylation reactions or phospholipase A1 degradation.

Database Links
Protein Families
2-acyl-GPE acetyltransferase family; ATP-dependent AMP-binding enzyme family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the bifunctional protein aas in Citrobacter koseri and how does it function in bacterial physiology?

The bifunctional protein aas in C. koseri possesses dual enzymatic activities: 2-acylglycerophosphoethanolamine acyltransferase and acyl-acyl carrier protein synthetase. This protein plays a critical role in membrane phospholipid turnover and homeostasis by recycling fatty acids from degraded phospholipids back into functional membrane components .

Methodology for functional characterization:

  • Conduct heterologous expression in E. coli expression systems using vectors such as pET or pBAD

  • Perform in vitro enzymatic assays using purified protein with:

    • Radiolabeled phospholipid substrates to track acyltransferase activity

    • ATP, CoA, and fatty acids to measure synthetase activity

  • Create knockout mutants in C. koseri to examine phenotypic changes in membrane composition

How is the aas gene structured and regulated in C. koseri compared to other Enterobacteriaceae?

While specific data on C. koseri aas regulation is limited, comparative genomic analyses can be conducted similar to other characterized genes in this organism such as blaCKO .

Methodological approach:

  • Perform promoter analysis using 5' RACE and reporter gene assays

  • Compare genetic organization with other Citrobacter species

  • Identify potential regulatory elements through bioinformatic analysis and DNA-protein interaction studies

  • Investigate environmental factors (pH, temperature, nutrient limitation) that modulate expression

An important consideration is that, unlike some chromosomal genes in C. koseri such as blaCKO, the aas gene may have upstream regulatory elements . Expression studies under different growth conditions can help elucidate these regulatory mechanisms.

What expression systems are optimal for producing recombinant C. koseri aas protein?

Recommended methodology:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coli BL21(DE3)High yield, simple inductionPotential inclusion bodiesLower temperature (16-20°C), reduced IPTG concentration
E. coli RosettaBetter codon optimizationModerate yieldSupplement with rare tRNAs
Cell-free systemsAvoids toxicity issuesHigher costOptimize redox conditions for membrane protein
Pichia pastorisBetter folding of complex proteinsLonger production timeOptimize methanol induction parameters

When selecting an expression system, consider that membrane-associated proteins like aas often require specialized approaches. Based on studies with other C. koseri proteins, co-expression with chaperones and using fusion tags (MBP, SUMO) can significantly improve solubility and functional yield .

How can structural characteristics of C. koseri aas be determined and what do they reveal about function?

Methodological approach:

  • X-ray crystallography or cryo-EM for high-resolution structure

  • Homology modeling based on related proteins

  • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

  • Site-directed mutagenesis of predicted catalytic residues followed by activity assays

Computational approaches similar to those used for identifying druggable targets in C. koseri can be applied to aas protein . For instance, molecular dynamics simulations can reveal conformational changes during substrate binding, while Alpha Fold predictions can provide initial structural models for experimental validation.

What purification strategies yield the highest purity and activity of recombinant aas protein?

Given the membrane-associated nature of aas, specialized purification protocols are required:

  • Membrane extraction protocol:

    • Cell lysis via sonication or French press

    • Differential centrifugation (10,000×g followed by 100,000×g)

    • Detergent solubilization (test panel: DDM, LDAO, CHAPS)

    • Gradient optimization required for detergent concentration (0.5-2%)

  • Chromatography sequence:

    • IMAC (if His-tagged) with imidazole gradient elution

    • Ion exchange chromatography (Resource Q or S)

    • Size exclusion chromatography (Superdex 200)

  • Activity preservation:

    • Include phospholipids during purification (0.01-0.05% E. coli total lipid extract)

    • Maintain reducing environment (1-5 mM DTT or TCEP)

    • Stabilize with glycerol (10-20%)

Monitor protein quality at each step using activity assays and thermal shift analysis to ensure the purification method preserves the bifunctional enzymatic activities.

How does C. koseri aas activity contribute to bacterial virulence and pathogenicity?

The potential role of aas in C. koseri virulence can be investigated through several approaches:

  • Create isogenic mutants (knockout and complemented strains)

  • Assess phenotypes relevant to pathogenicity:

    • Membrane integrity under stress conditions

    • Resistance to host antimicrobial peptides

    • Biofilm formation capacity

    • Cell invasion assays using relevant cell lines

This investigation is particularly relevant as C. koseri infections are primarily seen in immunocompromised individuals and those with underlying conditions . The bacterium possesses virulence factors associated with flagellar apparatus biosynthesis and iron uptake through a High Pathogenicity Island (HPI) gene cluster . Investigating how aas-mediated membrane remodeling interacts with these known virulence mechanisms would provide valuable insights.

How does the bifunctional nature of aas contribute to membrane remodeling during C. koseri infection and stress response?

Research methodology:

  • Use lipidomics to profile membrane changes during infection

    • LC-MS/MS analysis of phospholipid composition

    • Stable isotope labeling to track fatty acid recycling

  • Real-time monitoring of membrane dynamics

    • Fluorescent lipid analogs combined with microscopy

    • FRET-based assays for measuring membrane fluidity changes

  • Correlate membrane changes with stress responses

    • RNA-seq under various infection-relevant conditions

    • ChIP-seq to identify regulatory networks controlling aas

This research direction is particularly important considering C. koseri's remarkable pathogenic effects, especially on the central nervous system, which may be related to its ability to adapt to host environments .

What is the potential of C. koseri aas as a drug target for treating infections?

Similar to the computational approach used to identify druggable targets WP_012000829.1 and WP_275157394.1 in C. koseri , aas could be evaluated as a potential therapeutic target:

  • Target validation approach:

    • Demonstrate essentiality through conditional knockdown systems

    • Show attenuated virulence in infection models when aas is inhibited

    • Confirm absence of close human homologs to minimize off-target effects

  • Inhibitor discovery pathway:

    • Structure-based virtual screening (molecular docking)

    • Fragment-based drug design targeting catalytic pockets

    • High-throughput biochemical assays for primary screening

  • Evaluation of potential resistance mechanisms:

    • Frequency of spontaneous resistance

    • Cross-resistance with existing antibiotics

    • Synergistic combinations to prevent resistance development

Computational Parameters for Virtual Screening Against aas
Grid box dimensions: 60 × 60 × 60 Å
Exhaustiveness: 8
Energy range: 3 kcal/mol
Scoring function: AutoDock Vina

This approach would be particularly valuable given the increasing antimicrobial resistance in Citrobacter species to β-lactams, carbapenems, fluoroquinolones, and aminoglycosides .

How can CRISPR-Cas9 technology be applied to study aas function in C. koseri?

Methodological framework:

  • Design an optimized CRISPR-Cas9 system for C. koseri

    • Test various promoters for Cas9 expression

    • Evaluate sgRNA design algorithms for specificity

    • Optimize transformation protocols for C. koseri

  • Generate precise genetic modifications

    • Create clean deletions without resistance markers

    • Introduce point mutations to disrupt specific aas functions

    • Engineer domain swaps to test bifunctional activity independently

  • Implement CRISPRi for conditional knockdown

    • Titrate expression levels to identify threshold requirements

    • Create time-resolved expression profiles during infection

  • Construct reporter systems

    • Transcriptional fusions to monitor expression dynamics

    • Protein fusions to track subcellular localization

This genetic manipulation approach would provide unprecedented insights into aas function in C. koseri and potentially reveal new aspects of its role in bacterial physiology and pathogenesis.

How do environmental factors and host conditions modulate aas expression and activity in C. koseri during infection?

Research methodology:

  • In vitro mimicry of host environments:

    • Low pH to simulate phagolysosomal conditions

    • Iron limitation using chelators

    • Exposure to host defense peptides

    • Oxygen limitation models

  • Transcriptional analysis:

    • qRT-PCR of aas during different growth phases

    • RNA-seq to identify co-regulated genes

    • Promoter-reporter fusions to track expression in real-time

  • In vivo expression studies:

    • Infection models with tissue-specific RNA extraction

    • In vivo expression technology (IVET) to identify infection-induced genes

    • Single-cell transcriptomics from infected tissues

Given that C. koseri infections are particularly severe in immunocompromised individuals , understanding how host immune status affects aas expression would provide valuable insights into pathogenesis mechanisms.

What quality control measures are essential for working with recombinant C. koseri aas?

Quality control methodology:

  • Sequence verification of expression constructs

  • Western blotting with anti-aas antibodies

  • Mass spectrometry for protein identification and post-translational modifications

  • Enzymatic activity assays for both functional domains

  • Dynamic light scattering to assess aggregation state

  • Circular dichroism to confirm proper folding

Particular attention should be paid to protein stability during storage and handling, as bifunctional membrane-associated proteins like aas are prone to activity loss through improper folding or aggregation.

How can isothermal titration calorimetry (ITC) and surface plasmon resonance (SPR) be used to characterize aas interactions with substrates and inhibitors?

Methodological considerations:

ParameterITC ProtocolSPR Protocol
Sample preparationProtein concentration: 10-50 μM
Ligand concentration: 10-50× protein
Protein immobilization: 1000-3000 RU
Ligand preparation: 0.1-100 μM series
Buffer conditions50 mM HEPES, pH 7.4
150 mM NaCl
0.01% detergent
50 mM HEPES, pH 7.4
150 mM NaCl
0.005% P20 surfactant
ControlsHeat of dilution
Inactive protein variant
Reference cell (no protein)
Non-binding analogue
Data analysisOne-site binding model
Enthalpy-entropy compensation
Kinetic association/dissociation
Steady-state affinity analysis

These biophysical techniques provide complementary information about binding thermodynamics (ITC) and kinetics (SPR), essential for understanding substrate specificity and developing potential inhibitors.

What are the most promising future research directions for C. koseri aas?

Future research on C. koseri aas should focus on:

  • Detailed structural characterization to understand the bifunctional mechanism

  • Role in adaptation to host environments, particularly in immunocompromised settings

  • Contribution to antimicrobial resistance through membrane remodeling

  • Potential as a therapeutic target for treating C. koseri infections

  • Comparative analysis with aas proteins from other pathogens

The intersection of membrane biology and pathogenesis represents a particularly promising avenue, as C. koseri is known to cause severe infections, especially in vulnerable populations . Understanding how aas contributes to membrane adaptations during infection could reveal new therapeutic strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.