Recombinant Citrobacter koseri Cardiolipin synthase (cls)

Shipped with Ice Packs

In Stock

Cat. No.

BT2465370

Source

in vitro E.coli expression system

Synonyms

clsA; cls; CKO_01326; Cardiolipin synthase A; CL synthase

Quick Inquiry

Description

Functional Role of Cardiolipin Synthase

Cardiolipin synthase (cls) enzymes catalyze the final step in CL biosynthesis, which varies across organisms:

Bacterial Mechanism:
- Type I: Transfers a phosphatidyl group from phosphatidylglycerol (PG) to another PG, producing CL and glycerol.
- Type II: Utilizes CDP-diacylglycerol (CDP-DAG) as the phosphatidyl donor, forming CL and CMP (eukaryotic-like mechanism) .

Citrobacter koseri cls likely follows the bacterial Type I mechanism, as inferred from its classification in the phospholipase D superfamily .

Role in Membrane Stability and Bacterial Pathogenesis

CL is essential for maintaining membrane curvature, proton gradient stability, and virulence in pathogens. For example:

In Staphylococcus aureus, CL depletion via cls1 and cls2 deletion reduces cytotoxicity to neutrophils and virulence in mouse models .
In E. coli, CL synthesis is regulated by osmolarity and growth phase, with three distinct cls genes (clsA, clsB, clsC) ensuring redundancy .

Comparative Analysis of CLS Enzymes

Organism	CLS Type	Substrates	Key Function
E. coli	Type I (clsA/B)	PG + PG → CL + glycerol	Primary CL synthesis in log phase
Streptomyces	Type II	CDP-DAG + PG → CL + CMP	Eukaryotic-like CL synthesis
C. koseri	Type I (inferred)	PG + PG → CL + glycerol	Membrane stability, virulence

Experimental Insights from Recombinant CLS

The recombinant C. koseri cls protein is used in:

ELISA Assays: Detection of anti-cls antibodies in research or diagnostic settings .
Biochemical Studies: Characterization of CLS activity, substrate specificity, and inhibition kinetics.
Structural Biology: Crystallization and X-ray diffraction studies to elucidate active-site architecture.

Challenges and Future Directions

Mechanistic Gaps: The precise catalytic mechanism of C. koseri cls remains uncharacterized, necessitating in vitro assays to confirm substrate preferences.
Pathogenicity Links: Investigating whether CLS inhibition impacts C. koseri virulence, as seen in S. aureus .
Therapeutic Potential: Exploring CLS as a drug target for antimicrobial development, given CL’s role in bacterial membrane integrity.

Product Specs

Form

Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.

Lead Time

Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.

Notes

Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.

Reconstitution

Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your use.

Shelf Life

Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.

Storage Condition

Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.

Tag Info

Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.

Synonyms

clsA; cls; CKO_01326; Cardiolipin synthase A; CL synthase

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

1-486

Protein Length

full length protein

Species

Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

Target Names

clsA

Target Protein Sequence

MTTFYTVVSWLVILGYWILIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLSFGE LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAEENSSVASSLFKLCERRQGIAGVKGNQ LQLLTDSDDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAAARRGIHCRLMLD SAGSVAFFRSPWAAMMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMVMIDNYIAYTGSM NMVDPRFFKQDAGVGQWVDLMARMEGPVATAMGIVYSCDWEIETGKRILPPPPDVNIMPF EQASGHTIHTIASGPGFPEDLIHQALLTAAYSAREYLIMTTPYFVPSDDLLHAICTAAQR GVDVSIILPRKNDSMLVGWASRAFFTELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLVIDDAGFGGDLAAVQDDYISRSRLLDARLWVKRPLWQRITERLFY FFSPLL

Uniprot No.

A8AG50

Target Background

Function

Catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules to form cardiolipin (CL) (diphosphatidylglycerol) and glycerol.

Database Links

KEGG: cko:CKO_01326

STRING: 290338.CKO_01326

Protein Families

Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily

Subcellular Location

Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Citrobacter koseri Cardiolipin synthase (cls)

Description

Functional Role of Cardiolipin Synthase

Role in Membrane Stability and Bacterial Pathogenesis

Comparative Analysis of CLS Enzymes

Experimental Insights from Recombinant CLS

Challenges and Future Directions

Product Specs

Target Background

Quick Inquiry

Category

Service