Recombinant Citrobacter koseri Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Introduction to Cobalamin Synthase (CobS)

Cobalamin synthase (CobS) is a critical enzyme in the biosynthesis pathway of cobalamin (vitamin B12), a cofactor essential for DNA synthesis, amino acid metabolism, and energy production. In Citrobacter koseri, a Gram-negative pathogen associated with neonatal meningitis and brain abscesses, CobS catalyzes the final steps of adenosylcobalamin (AdoCbl) biosynthesis. Recombinant CobS refers to the enzyme produced via genetic engineering in heterologous systems (e.g., Escherichia coli), enabling detailed biochemical and structural studies .

Functional Role of CobS in Cobalamin Biosynthesis

CobS operates in the nucleotide loop assembly (NLA) pathway, a conserved process in bacteria and archaea. Key functions include:

  • Substrate Binding: CobS condenses adenosylcobinamide-GDP (AdoCbi-GDP) and α-ribazole-phosphate (α-RP) to form adenosylcobalamin-5′-phosphate (AdoCbl-P) .

  • Membrane Association: CobS is a polytopic integral membrane protein, requiring interaction with phospholipid bilayers for activity .

  • Collaborative Catalysis: Works alongside CobC (phosphatase) to dephosphorylate AdoCbl-P into bioactive AdoCbl .

Key Features

  • Domain Architecture: CobS contains multiple transmembrane helices, critical for membrane localization and substrate channeling .

  • Catalytic Residues: Asp82 is essential for enzymatic activity; mutations (e.g., D82A) abolish function .

  • Kinetics: CobS binds AdoCbi-GDP and α-RP with high affinity (nanomolar range) .

Comparative Analysis of CobS Across Species

FeatureC. koseri (Predicted)Salmonella entericaPseudomonas denitrificans
PathwayAnaerobicAnaerobicAerobic
Membrane AssociationIntegralIntegralSoluble
Cofactor RequirementNoneNoneFlavin-dependent
Gene Clustercob operoncob/cbi operoncob operon
Data inferred from homologous systems .

4.1. Impact of CobS Overproduction

  • Membrane Disruption: Elevated CobS levels in E. coli dissipate the proton motive force (PMF), increase membrane permeability, and reduce viability .

  • Stress Response: Triggers overexpression of phage shock protein A (PspA), a PMF-stabilizing factor .

4.2. Enzymatic Rescue Mechanisms

  • CobC Phosphatase Synergy: Coexpression of CobC mitigates CobS toxicity by accelerating AdoCbl-P dephosphorylation .

  • Liposome Reconstitution: Functional studies show CobS activity depends on membrane integration and CobC binding .

Genomic and Phylogenetic Context in C. koseri

  • Pathogenicity Link: While C. koseri’s virulence is linked to iron acquisition (e.g., high-pathogenicity island [HPI] clusters), its cobalamin biosynthesis genes (including cobS) remain conserved across strains .

  • Antibiotic Resistance: Carbapenem-resistant C. koseri strains (e.g., blaNDM-1 carriers) show no direct correlation between cobS and resistance mechanisms .

Challenges in Recombinant CobS Production

  • Membrane Protein Complexity: Heterologous expression of polytopic membrane proteins like CobS often requires optimized folding and lipid environments .

  • Toxicity Management: Inducible expression systems are critical to avoid cell membrane damage .

Future Directions

  • Structural Studies: Cryo-EM or X-ray crystallography of C. koseri CobS could elucidate substrate-binding pockets.

  • Therapeutic Targeting: CobS inhibitors might disrupt cobalamin-dependent pathogens without affecting human hosts.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use and avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your desired tag type for preferential development.
Synonyms
cobS; CKO_00821; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Target Names
cobS
Target Protein Sequence
MSKLFWAMLAFISRLPVPTRWSQGLDFEEYSRGIVTFPLIGMLLGAIGGLVFVALQSWCG IPLAALFCVLTLALLTGGFHLDGLADTCDGIFSARRRERMLEIMRDSRLGTHGGLALIFV LLAKVLVISELALRGTPMLAALAMACAAGRGVAVLLMYRHRYAREEGLGNVFIGKVTGRQ TCVTLGLTAILAAILMPGMHGVAALVVTLAAIFILGQLLKRTLGGQTGDTLGAAIELGEL IFLLALL
Uniprot No.

Target Background

Function

Recombinant Citrobacter koseri Cobalamin Synthase (CobS) catalyzes the synthesis of adenosylcobalamin (Ado-cobalamin) from adenosylcobinamide-GDP and α-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and α-ribazole 5'-phosphate.

Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cobalamin synthase (CobS) and what is its role in bacterial metabolism?

Cobalamin synthase (CobS) is a polytopic integral membrane protein that catalyzes the penultimate step in the cobalamin (vitamin B12) biosynthesis pathway. Specifically, it functions as a cobamide (5'-phosphate) synthase, condensing activated precursors in the late stages of cobalamin biosynthesis . This enzyme is essential for organisms that synthesize cobalamin de novo, which includes certain bacteria and archaea, though not eukaryotes.

In bacterial metabolism, CobS plays a critical role in producing coenzyme B12, which serves as a cofactor for various enzymatic reactions including methylation, reduction, and intramolecular rearrangements. The significance of this enzyme is underscored by the fact that polytopic homologues of CobS are present in genomes of all bacteria and archaea that synthesize cobamides .

How is the cobS gene identified and characterized in C. koseri genome?

While the search results don't specifically detail the cobS gene in C. koseri, we can infer its presence based on comparative genomics. C. koseri strain MPUCK001 has been fully sequenced, revealing a 4.9-Mbp genome with 4,536 protein-coding sequences . The cobS gene would be among these protein-coding sequences, identifiable through homology with known cobS genes from related species.

Researchers typically employ bioinformatic approaches to identify the cobS gene within the C. koseri genome:

  • BLAST alignment with known cobS sequences from related Enterobacteriaceae

  • Analysis of genomic context (nearby genes in the cobalamin biosynthesis pathway)

  • Identification of characteristic membrane protein domains

The expected features of the cobS gene would include coding sequences for transmembrane domains, as CobS is known to be a polytopic integral membrane protein .

What structural characteristics distinguish C. koseri CobS from other bacterial species?

Without specific structural data on C. koseri CobS in the search results, comparative analysis suggests that as a member of the Enterobacteriaceae family, C. koseri's CobS likely shares significant structural homology with those from related species like E. coli and Salmonella. Key structural features would include:

  • Multiple transmembrane domains characteristic of polytopic membrane proteins

  • Active site residues essential for the condensation reaction

  • Potential interaction domains for forming complexes with other proteins in the pathway

The D82 residue appears to be critical for CobS function, as a D82A mutation renders the enzyme inactive while still causing membrane perturbation when overexpressed .

How does overexpression of recombinant CobS affect cellular physiology?

Overexpression of CobS has profound effects on cellular physiology, primarily due to its membrane-associated nature. Research on E. coli expressing Salmonella CobS demonstrates that elevated levels of CobS:

  • Dissipate the proton motive force (PMF)

  • Increase membrane permeability

  • Significantly reduce cell viability in a dose-dependent manner

  • Inhibit cell division, resulting in elongated cells lacking divisional septa

These effects occur regardless of whether the overexpressed CobS is catalytically active or inactive (D82A mutant), suggesting the membrane disruption is due to the physical presence of excess membrane protein rather than its enzymatic activity .

IPTG ConcentrationEffect on Cell Viability (CobS WT)Effect on Cell Viability (CobS D82A)
0.5 mMSignificant decrease (P = 0.0003)Significant decrease (P < 0.0001)
1.0 mMSignificant decrease (P = 0.0014)Significant decrease (P = 0.0003)

Table 1: Impact of CobS overexpression on cell viability at different inducer concentrations

What strategies can mitigate the negative effects of CobS overexpression?

Research has identified two effective strategies to counteract the detrimental effects of CobS overexpression:

  • Co-expression with CobC: The cobC gene encodes the phosphatase that catalyzes the final step of the cobalamin biosynthesis pathway. Co-expression of CobC with CobS ameliorates the negative effects on membrane integrity and cell viability .

  • Co-expression with PspA: Phage shock protein A (PspA) plays a role in PMF maintenance. Balanced co-expression of PspA with CobS counteracts the membrane disruption caused by CobS overexpression .

These findings suggest that CobS likely functions as part of a multienzyme complex in vivo, and isolated expression disrupts normal membrane physiological processes .

What interactions does CobS form within the cobalamin biosynthesis pathway?

Evidence suggests that CobS anchors a multienzyme complex that catalyzes the late steps of cobalamin biosynthesis. Key interactions include:

  • CobS-CobC interaction: In vitro studies show that the association of the CobC phosphatase with liposomes depends on the presence of CobS in the liposome, suggesting a direct interaction between these proteins .

  • CobS-CbiB interaction: CobS and CbiB (AdoCbi-P synthase) are both polytopic integral membrane proteins involved in the cobalamin biosynthesis pathway, suggesting potential functional interaction .

These interactions likely facilitate substrate channeling and enhance the efficiency of the biosynthetic pathway, explaining why isolated overexpression of CobS is detrimental to cellular function.

What expression systems are optimal for recombinant C. koseri CobS production?

Based on the challenges associated with CobS overexpression, researchers should consider the following expression approaches:

  • Regulated expression systems: Use tightly controlled inducible promoters (such as the IPTG-inducible system) with careful titration of inducer concentration to prevent excessive CobS accumulation .

  • Co-expression strategies: Simultaneously express CobS with its partner proteins, particularly CobC and/or PspA, to mitigate membrane disruption .

  • Host strain selection: Consider using C. koseri itself as an expression host, as it naturally contains the complementary proteins for cobalamin biosynthesis.

  • Membrane protein expression vectors: Utilize specialized vectors designed for membrane protein expression that include appropriate signal sequences and fusion partners.

What methods are effective for assessing CobS functionality?

Several complementary approaches can be used to evaluate CobS functionality:

  • Membrane integrity assays:

    • Ethidium bromide accumulation assay to assess PMF disruption

    • TO-PRO-3 uptake to measure membrane permeability

    • DiOC2 staining to monitor membrane potential

  • Cell viability measurements:

    • Colony-forming unit (CFU) counts following CobS expression

    • Live/dead cell staining and microscopy

  • Enzyme activity assays:

    • In vitro reconstitution using liposomes with purified CobS

    • Detection of AdoCba-P formation from appropriate substrates

How can researchers perform site-directed mutagenesis studies on C. koseri CobS?

Site-directed mutagenesis is valuable for structure-function studies of CobS. Based on existing research, the following approach is recommended:

  • Target residue selection:

    • Focus on the D82 residue, which is critical for catalytic activity but not for membrane association

    • Target predicted transmembrane domains to investigate membrane integration

    • Identify putative substrate binding residues through homology modeling

  • Mutagenesis protocol:

    • Use overlap extension PCR or commercial mutagenesis kits

    • Confirm mutations by DNA sequencing

    • Express both wild-type and mutant proteins in parallel

  • Functional comparison:

    • Compare enzymatic activity in reconstituted systems

    • Assess membrane effects to differentiate between catalytic and structural roles

    • Evaluate protein-protein interactions using co-immunoprecipitation or crosslinking

How might genomic analysis of C. koseri inform CobS research?

The complete genome sequence of C. koseri strain MPUCK001 provides valuable resources for CobS research . Researchers should:

  • Analyze the genomic context of the cobS gene to identify potential regulatory elements and co-regulated genes

  • Compare the cobS gene sequence across multiple C. koseri strains to identify conserved regions

  • Investigate potential horizontal gene transfer events involving cobS by examining GC content and codon usage

What techniques can be employed to study the CobS-anchored multienzyme complex?

Understanding the multienzyme complex anchored by CobS requires sophisticated structural and functional approaches:

  • Crosslinking coupled with mass spectrometry to identify interaction partners

  • Cryo-electron microscopy to visualize the membrane-associated complex

  • Proximity labeling techniques (BioID, APEX) to identify proteins in close vicinity to CobS in vivo

  • Fluorescence resonance energy transfer (FRET) to study dynamic interactions between CobS and partner proteins

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.