Recombinant Citrobacter koseri Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Metabolism

RnfE is a subunit of the Rnf (Rhodobacter nitrogen fixation) complex, a membrane-bound electron transport system critical for energy conservation. Key functions include:

  • Electron Transfer: Couples ferredoxin oxidation to NAD+ reduction, generating ion gradients (Na+/H+) for ATP synthesis .

  • Metabolic Versatility: Supports anaerobic respiration and redox balancing in C. koseri .

  • Pathogenicity Link: Rnf complexes in related pathogens contribute to virulence by maintaining redox homeostasis under host conditions .

Table 1: Comparative Rnf Complex Roles in Bacteria

OrganismRnf Complex FunctionEnergy Coupling IonReference
Citrobacter koseriElectron transport, redox balancingNa+
Acetobacterium woodiiFerredoxin:NAD+ oxidoreductase activityNa+
Rhodobacter capsulatusNitrogen fixation, electron transportH+

Applications in Research

Recombinant RnfE is utilized in:

  • Enzyme-Linked Immunosorbent Assay (ELISA): Detects antibodies or ligands interacting with RnfE .

  • Structural Studies: AlphaFold predictions suggest RnfE’s role in stabilizing the Rnf complex .

  • Antimicrobial Target Identification: Rnf complexes are explored for novel drug targets due to their essential metabolic roles .

Key Research Findings

  • Antibacterial Susceptibility: C. koseri strains show intermediate sensitivity to bactericidal agents like rBPI21 (IC50 ~1,000 nM) .

  • Host-Pathogen Interactions: Rnf-mediated electron transport may enhance survival in host environments, such as macrophages .

  • Genomic Insights: The rnf operon is conserved in C. koseri, highlighting its metabolic adaptability .

Table 2: Antibacterial Activity Against C. koseri

AgentTarget PathwayIC50 (nM)Reference
rBPI21Membrane disruption1,000
AmpicillinCell wall synthesis>10,000

Future Research Directions

  • Mechanistic Studies: Elucidate RnfE’s role in Na+ translocation using cryo-EM or X-ray crystallography.

  • Therapeutic Exploration: Screen small-molecule inhibitors targeting RnfE’s ferredoxin-binding site .

  • Metabolic Engineering: Optimize RnfE expression for bioenergy applications .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please contact your local distributor.
Note: All our proteins are shipped standard with blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. This can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please let us know, and we will prioritize development of the specified tag.
Synonyms
rnfE; CKO_01644; Ion-translocating oxidoreductase complex subunit E; Rnf electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Target Names
CKO_01644
Target Protein Sequence
MSEIKDVIVQGLWKNNSALVQLLGMCPLLAVTSTATNALGLGLATTLVLTLTNLTISALR RWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFSIGMGATGAMFVLGSMREIIGNGTLFDGADGLLGDWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAEAVAAELPSGETGNV
Uniprot No.

Target Background

Function
This protein is part of a membrane-bound complex that facilitates coupling of electron transfer with ion translocation across the membrane.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Rnf complex and what role does RnfE play within it?

The Rnf (Rhodobacter nitrogen fixation) complex is a membrane-bound electron transport system that couples ion transport to electron transfer, contributing to energy conservation in various bacteria. In C. koseri, the Rnf complex consists of several subunits including RnfA, RnfE, and others that work together to establish ion gradients across the membrane. RnfE specifically functions as a transmembrane component of this complex, containing hydrophobic domains that anchor within the membrane and facilitate electron transport . The protein contains 230 amino acids and features multiple transmembrane helices that are critical for its function in establishing electrochemical gradients used for ATP synthesis and other cellular processes .

What are the structural characteristics of C. koseri RnfE protein?

The C. koseri RnfE protein (UniProt accession: A8AH13) consists of 230 amino acids with multiple hydrophobic regions that form transmembrane domains. Analysis of its sequence reveals characteristic motifs consistent with electron transport proteins, including conserved charged residues that likely participate in proton or sodium ion transfer . The protein contains multiple membrane-spanning regions that anchor it within the cytoplasmic membrane. Secondary structure prediction indicates approximately 60% alpha-helical content, predominantly in the transmembrane regions, with connecting loops containing more disordered structures. The protein shares significant homology with RnfE proteins from other bacterial species, particularly within the Enterobacteriaceae family .

How does the RnfE protein contribute to C. koseri metabolism and pathogenicity?

As a component of the electron transport chain, RnfE contributes to energy metabolism in C. koseri by participating in redox reactions that generate proton-motive force. This energy conservation mechanism is particularly important during growth under anaerobic or microaerobic conditions, which C. koseri may encounter during infection . While not directly identified as a virulence factor in the genomic studies of C. koseri, the Rnf complex's role in energy metabolism indirectly supports pathogenicity by enabling bacterial survival and growth under the variable energy conditions encountered during infection . Comparative genomic analyses have revealed that electron transport components may contribute to the organism's ability to colonize different host environments, though the specific contribution of RnfE to virulence requires further investigation .

What are the optimal expression systems for producing recombinant C. koseri RnfE protein?

Expression of membrane proteins like RnfE presents significant challenges due to their hydrophobic nature. For recombinant production of C. koseri RnfE, E. coli-based expression systems with specific modifications for membrane protein production are recommended. The pET expression system with C41(DE3) or C43(DE3) host strains, which are designed for membrane protein expression, typically yields better results than standard BL21(DE3) strains .

Expression protocols should include:

  • Induction with low IPTG concentrations (0.1-0.5 mM)

  • Lower growth temperatures (16-25°C) during expression

  • Addition of membrane-stabilizing compounds (glycerol, specific detergents)

  • Codon optimization for the expression host

For larger-scale production, controlled fermentation with monitoring of dissolved oxygen levels is essential to maintain proper membrane formation and protein insertion .

What purification strategies are most effective for RnfE protein while maintaining its native conformation?

Purification of RnfE requires specialized approaches due to its membrane-embedded nature:

Purification StepRecommended ConditionsCritical Considerations
Membrane extractionGentle lysis using French press or sonicationAvoid harsh detergents that may denature protein
Solubilizationn-Dodecyl β-D-maltoside (DDM) or digitonin (0.5-1%)Concentration should be optimized to prevent aggregation
Affinity chromatographyHis-tag purification with imidazole gradient elutionLow imidazole in wash buffers to prevent non-specific binding
Size exclusionSuperdex 200 column with detergent in bufferCritical for removing aggregates and ensuring homogeneity
Buffer composition50 mM Tris-HCl pH 7.5, 150 mM NaCl, 5% glycerol, detergent above CMCBuffer stability is essential for maintaining native conformation

Throughout purification, it's critical to maintain the protein in detergent micelles above their critical micelle concentration (CMC) to prevent protein aggregation. Functional assays should be performed after each purification step to ensure the protein maintains its electron transport capability .

How can researchers assess the functional activity of purified recombinant RnfE?

Functional characterization of RnfE requires assessment of its electron transport capabilities. This can be accomplished through several complementary approaches:

  • Reconstitution into proteoliposomes: Incorporate purified RnfE into artificial lipid bilayers and measure ion transport using fluorescent probes sensitive to membrane potential or specific ions.

  • Electron transfer assays: Utilize artificial electron donors and acceptors (such as reduced methyl viologen and various quinones) to measure electron transfer rates spectrophotometrically.

  • Membrane potential measurements: Monitor changes in membrane potential using voltage-sensitive dyes when RnfE is integrated into membranes and provided with appropriate substrates.

  • Complementation studies: Express RnfE in RnfE-deficient bacterial strains and assess restoration of electron transport functions or growth under specific metabolic conditions.

Importantly, full functional characterization often requires reconstituting the entire Rnf complex, as RnfE alone may not display complete functionality without its partner proteins (RnfA, RnfB, RnfC, RnfD, and RnfG) .

How can crystal structures or cryo-EM be used to determine the three-dimensional structure of RnfE?

Determining the three-dimensional structure of membrane proteins like RnfE presents unique challenges. For crystallography approaches:

  • Protein engineering: Create fusion constructs with crystallization chaperones like T4 lysozyme or BRIL inserted into loop regions to enhance crystal contacts without disrupting transmembrane regions.

  • Lipidic cubic phase (LCP) crystallization: Utilize LCP matrices which provide a membrane-mimetic environment favorable for membrane protein crystallization.

  • Detergent screening: Systematically evaluate different detergents and detergent mixtures to identify conditions that maintain native protein folding while promoting crystal formation.

For cryo-EM approaches:

  • Sample preparation optimization: Use nanodiscs or amphipols to maintain protein stability without large detergent micelles that reduce contrast.

  • Focused refinement: Implement computational approaches that account for the flexibility of different domains.

  • Molecular dynamics simulations: Combine structural data with molecular dynamics to model protein behavior within the membrane environment.

Recent advances in AlphaFold and other prediction tools can provide initial structural models to guide experimental design, as demonstrated in recent studies of potential drug targets in C. koseri .

What approaches can be used to investigate protein-protein interactions between RnfE and other components of the Rnf complex?

Investigating the interactions between RnfE and other components of the Rnf complex requires specialized techniques for membrane protein complexes:

  • Crosslinking mass spectrometry (XL-MS): Use chemical crosslinkers of varying lengths to capture protein-protein interactions, followed by mass spectrometry analysis to identify interaction sites.

  • Co-purification strategies: Employ tandem affinity purification with tags on different complex components to isolate intact complexes.

  • Bacterial two-hybrid systems: Modified for membrane proteins, these systems can detect interactions between RnfE and other Rnf components in vivo.

  • FRET-based approaches: Engineer fluorescent protein fusions to detect proximity between different Rnf components when expressed in cells.

  • Surface plasmon resonance (SPR): Immobilize purified RnfE on sensor chips and measure binding kinetics with other purified Rnf components.

Analysis of protein interaction networks can be particularly informative when combined with genomic data from different Citrobacter species, as comparative genomic approaches have revealed differences in protein interactions that may contribute to species-specific characteristics .

How can researchers use molecular dynamics simulations to understand RnfE function within the membrane?

Molecular dynamics (MD) simulations provide valuable insights into membrane protein behavior within lipid bilayers:

  • System preparation: Build a simulation system containing the RnfE protein (based on experimental structures or homology models) embedded in a lipid bilayer that mimics the bacterial inner membrane composition.

  • Simulation parameters:

    • Use specialized force fields optimized for membrane proteins (CHARMM36, AMBER Lipid17)

    • Include explicit water and ions at physiological concentrations

    • Simulate for sufficient time (typically >100 ns) to observe conformational changes

  • Analysis approaches:

    • Monitor protein stability and conformational changes

    • Track water molecules or ions moving through potential channels

    • Calculate electrostatic potential maps across the membrane

    • Identify lipid binding sites on the protein surface

  • Enhanced sampling techniques:

    • Implement replica exchange, metadynamics, or umbrella sampling to explore energy landscapes more efficiently

    • Focus on specific domains involved in electron or ion transport

These simulations can generate hypotheses about functional mechanisms that can then be tested experimentally, such as identifying key residues for mutagenesis studies .

How does C. koseri RnfE compare structurally and functionally to similar proteins in other bacterial species?

Comparative analysis reveals that RnfE proteins are widely distributed among bacterial species, with important structural and functional variations:

SpeciesRnfE Sequence Identity (%)Functional DifferencesEcological Niche
Citrobacter koseri100 (reference)Standard electron transport functionOpportunistic pathogen, gut commensal
Citrobacter freundii~90-95Similar core functionEnvironmental, opportunistic pathogen
Escherichia coli~80-85Variable presence in different strainsGut commensal, pathogenic variants
Salmonella enterica~75-80Similar function, different regulationIntracellular pathogen
Vibrio cholerae~50-60Na⁺-dependent variantAquatic environment, intestinal pathogen
Clostridium species~30-40Fermentative metabolism adaptationAnaerobic environments

These variations reflect adaptations to different ecological niches and metabolic requirements. Notably, the Rnf complex in some species functions with Na⁺ rather than H⁺ as the coupling ion, reflecting adaptations to different environmental conditions. Phylogenetic analysis across the genus Citrobacter has revealed that core metabolic functions, including electron transport complexes, show significant conservation despite divergence in other genomic regions .

What role might RnfE play in antibiotic resistance or as a potential drug target in C. koseri?

While RnfE itself has not been directly implicated in antibiotic resistance, its role in energy metabolism makes it relevant to antimicrobial research:

  • Indirect contribution to resistance: By maintaining energy homeostasis under stress conditions, the Rnf complex may indirectly support survival during antibiotic exposure.

  • Potential drug target considerations:

    • Essential for anaerobic growth, making it potentially valuable for targeting infections in low-oxygen environments

    • Highly conserved across bacterial species, raising selectivity challenges

    • Membrane localization provides accessibility for certain drug classes

  • Targeting approaches:

    • Small molecules that disrupt electron transfer within the complex

    • Compounds that interfere with complex assembly

    • Peptides that disrupt protein-protein interactions within the complex

Recent in silico studies have identified other potential druggable targets in C. koseri, providing a framework for similar approaches to evaluate RnfE as a therapeutic target . The comparative genomic analysis of Citrobacter species has also revealed differences in antibiotic susceptibility profiles between C. koseri and C. freundii that might be related to differences in metabolic capabilities .

What are common challenges in expressing and purifying functional RnfE protein, and how can they be overcome?

Researchers frequently encounter several challenges when working with RnfE:

  • Low expression levels:

    • Solution: Optimize codon usage for expression host

    • Use stronger promoters or increase copy number

    • Test expression in specialized membrane protein expression strains

  • Protein misfolding and aggregation:

    • Solution: Lower expression temperature (16-20°C)

    • Add membrane-stabilizing compounds (glycerol, specific lipids)

    • Test different detergents for solubilization

  • Poor stability after purification:

    • Solution: Screen buffer conditions (pH, salt concentration, additives)

    • Include lipids or lipid-like molecules during purification

    • Use protein stabilizing agents like glycerol or specific binding partners

  • Loss of function during purification:

    • Solution: Verify function at each purification step

    • Co-express with other Rnf complex components

    • Consider native-like membrane mimetics (nanodiscs, SMALPs) for maintaining the native environment

  • Difficulty in reconstituting activity:

    • Solution: Test different lipid compositions for proteoliposome formation

    • Ensure proper orientation in the membrane

    • Co-reconstitute with other Rnf complex components

Each of these challenges requires systematic optimization approaches, often requiring multiple iterations to achieve successful outcomes .

How can researchers design effective mutagenesis studies to investigate structure-function relationships in RnfE?

Strategic mutagenesis approaches can provide valuable insights into RnfE function:

  • Target selection strategies:

    • Conserved residues identified through multiple sequence alignments

    • Charged residues within transmembrane domains (potential ion transport sites)

    • Residues at predicted protein-protein interfaces based on structural models

    • Regions with predicted cofactor binding sites

  • Mutagenesis approaches:

    • Alanine scanning of selected regions to identify essential residues

    • Conservative substitutions to probe specific chemical properties

    • Introduction of reporter groups (cysteine residues for labeling)

    • Domain swapping with homologous proteins to identify functional regions

  • Functional assessment:

    • Growth complementation assays in rnfE deletion strains

    • In vitro reconstitution and activity measurements

    • Protein stability and complex formation analysis

  • Data interpretation considerations:

    • Distinguish between effects on protein stability versus specific function

    • Consider potential long-range effects of mutations on protein conformation

    • Examine consequences for interactions with other Rnf complex components

Combining mutagenesis with structural and biochemical approaches provides the most comprehensive understanding of structure-function relationships in this complex membrane protein .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.