Recombinant Citrobacter koseri Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Description

Molecular Overview and Production

Recombinant C. koseri frdC is produced in E. coli with an N-terminal His tag for purification. Key specifications include:

PropertyDetail
UniProt IDA8AMP4
Protein Length131 amino acids (1-131aa)
SequenceMTTKRKAYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKHGAESWMGFVGFLQNPVVVILNLIALAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKGLWVVTAVVTVVILYVALYW
Purity>90% (SDS-PAGE)
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0)

The protein is lyophilized and requires reconstitution in deionized water, with glycerol (5–50%) recommended for long-term stability .

Functional Role in Bacterial Metabolism

FrdC is a membrane-anchored subunit of the fumarate reductase complex (QFR), which facilitates electron transfer during anaerobic respiration. Key insights:

  • Operon Structure: In E. coli, the frdABCD operon encodes all four subunits (A: flavoprotein, B: iron-sulfur protein, C/D: membrane anchors). Co-expression of all subunits is essential for functional assembly .

  • Membrane Association: FrdC and FrdD are required for membrane integration and quinone binding, enabling fumarate reduction .

  • Metabolic Context: This complex allows C. koseri to thrive in anaerobic host environments, such as the human gut or abscesses .

Pathogenicity and Research Applications

While frdC itself is not a virulence factor, its role in metabolism supports C. koseri survival in hostile environments:

  • In Vivo Studies: C. koseri mutants lacking pathogenicity islands (e.g., HPI) show reduced colonization in neonatal rat brains, highlighting the interplay between metabolism and virulence .

  • Antibiotic Resistance: C. koseri exhibits resistance to cephalosporins, aminoglycosides, and quinolones . Studying frdC could inform therapies targeting anaerobic pathways.

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.

Synonyms
frdC; CKO_03680; Fumarate reductase subunit C; Fumarate reductase 15 kDa hydrophobic protein; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Target Names
frdC
Target Protein Sequence
MTTKRKAYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKHGAESWMGF VGFLQNPVVVILNLIALAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKGLWVVTAVV TVVILYVALYW
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is employed during anaerobic growth, while succinate dehydrogenase functions in aerobic growth. This subunit anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links
Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does Citrobacter koseri differ from other Citrobacter species, and why is it significant for frdC research?

Citrobacter koseri is a gram-negative, non-spore forming, rod-shaped facultative anaerobic bacterium belonging to the Enterobacteriaceae family . While several Citrobacter species are opportunistic pathogens, C. koseri demonstrates some distinct characteristics:

CharacteristicC. koseriC. freundiiOther Citrobacter species
Brain tropismHigh affinity for brain tissueLower affinityVariable
Antibiotic susceptibilityMore susceptible to antibioticsLess susceptibleVariable
Pathogenicity factorsHas HPI cluster for iron uptakeHas VI capsule polysaccharideVariable
Secretion systemsContains T6SS-2 genes onlyMore diverse secretion systemsVariable

C. koseri exhibits a remarkable degree of tropism for the brain, with a particular tendency to cause meningitis and brain abscesses in neonates and immunocompromised individuals . This tropism has been associated with a unique 32 kilodalton outer-membrane protein and the presence of a High Pathogenicity Island (HPI) gene cluster that enables iron uptake in iron-deficient environments such as the central nervous system . These distinctive characteristics make C. koseri particularly interesting for virulence research, with frdC potentially playing a role in its metabolic adaptation during infection .

What are the recommended methods for recombinant expression of C. koseri frdC protein?

Based on current research protocols, the following methodology is recommended for recombinant expression of C. koseri frdC:

Recombinant Expression Protocol:

  • Vector Selection:

    • pET-28a(+) has been successfully used for expression of Citrobacter proteins

    • Include an N-terminal or C-terminal His-tag for purification purposes

  • Host System:

    • E. coli strain K12 derivatives are commonly used for expression

    • BL21(DE3) is particularly suitable for membrane proteins like frdC

  • Expression Conditions:

    • Culture at 37°C in LB broth until mid-log phase

    • Induce with IPTG (0.1-1.0 mM)

    • Reduce temperature to 18-25°C post-induction to improve folding of membrane proteins

    • Continue expression for 4-16 hours

  • Purification Strategy:

    • Cell lysis using sonication or pressure-based methods

    • Membrane fraction isolation by ultracentrifugation

    • Solubilization with detergents (commonly DDM, LDAO, or Triton X-100)

    • Affinity purification using Ni-NTA for His-tagged protein

    • Consider size exclusion chromatography as a final polishing step

  • Storage Conditions:

    • Store in Tris-based buffer with 50% glycerol at -20°C for extended storage

    • Avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

It's important to note that as a membrane protein, frdC may present challenges in expression and purification that require optimization of detergent conditions and expression parameters for each specific experimental setup.

How can researchers verify the functional activity of recombinant frdC?

Verification of recombinant frdC functionality requires multiple approaches:

  • Biochemical Assays:

    • Fumarate reductase activity can be measured spectrophotometrically by monitoring the oxidation of reduced benzyl viologen at 578 nm in the presence of fumarate

    • Reconstitution assays with other fumarate reductase complex components (frdA, frdB, frdD) to assess proper complex formation

  • Membrane Integration Analysis:

    • Membrane fractionation followed by Western blotting to confirm localization

    • Protease accessibility assays to determine proper topology

    • Fluorescence microscopy using GFP-tagged constructs to visualize membrane localization

  • Structural Integrity Assessment:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Limited proteolysis to evaluate proper folding

    • Size exclusion chromatography to determine oligomeric state

  • Functional Complementation:

    • Genetic complementation in frdC-knockout strains to restore fumarate reductase activity

    • Growth assays under anaerobic conditions with fumarate as the sole electron acceptor

These multifaceted approaches provide comprehensive validation of recombinant frdC functionality, essential for subsequent research applications.

How is recombinant C. koseri frdC being utilized in antimicrobial resistance research?

Recombinant C. koseri frdC is becoming increasingly important in antimicrobial resistance research through several approaches:

  • Comparative Genomic Analysis:

    • Researchers have conducted comparative studies of fumarate reductase genes across Citrobacter species to understand variations that may contribute to differential antibiotic susceptibility

    • Unlike C. freundii which shows inherent resistance to many antimicrobials, C. koseri demonstrates higher susceptibility to antibiotics, making comparative studies of proteins like frdC valuable for understanding resistance mechanisms

  • Drug Target Identification:

    • Subtractive proteomics approaches have identified potential protein targets, including metabolic proteins like frdC, for novel antimicrobial development

    • Structural analysis of recombinant frdC can facilitate structure-based drug design targeting this essential metabolic pathway

  • Resistance Mechanism Studies:

    • Research has shown that C. koseri has acquired resistance to β-lactams, carbapenems, fluoroquinolones, and aminoglycosides

    • Recombinant expression systems allow investigation of how mutations in metabolic proteins like frdC might contribute to adapted metabolic states that support antibiotic resistance

  • Biofilm Formation Research:

    • Anaerobic respiratory proteins like frdC may play roles in biofilm formation, which contributes to antimicrobial resistance

    • Recombinant frdC enables studies of protein-specific contributions to biofilm development through knockout and complementation studies

Analysis of clinical isolates from both hospital and community settings has shown significant differences in resistance patterns, with higher resistance rates observed in nosocomial samples (84.88% compared to 15.12% from outdoor specimens) . This makes research on C. koseri proteins, including frdC, particularly relevant for addressing hospital-acquired infections.

What is the significance of frdC in vaccine development research against C. koseri?

While frdC itself has not been directly identified as a primary vaccine target in the search results, the research methodology being applied to C. koseri antigens is relevant for understanding how membrane proteins like frdC might be evaluated:

  • Subtractive Proteomics Approach:

    • Recent research has utilized subtractive proteomics to identify potential antigenic proteins for vaccine development against C. koseri

    • This computational approach could be applied to evaluate frdC's potential as a vaccine candidate

  • Epitope Mapping Methodology:

    • Researchers have identified B and T cell epitopes from specific C. koseri proteins using immunoinformatic and bioinformatic resources

    • Similar methods could be applied to analyze frdC for immunogenic epitopes

  • Multi-Epitope Vaccine Design:

    • Current vaccine development strategies combine multiple epitopes including cytotoxic T cell lymphocytes (CTL), helper T cell lymphocyte (HTL), and linear B cell lymphocyte (LBL) epitopes

    • If immunogenic regions were identified in frdC, they could potentially be incorporated into such multi-epitope vaccines

  • Vaccine Evaluation Framework:

    • Modern vaccine candidates undergo computational evaluation for stability, antigenicity, and allergenicity before in vitro and animal testing

    • The binding affinity and interactions with human immunological receptors like TLR3 are studied using molecular docking, molecular dynamics simulations, and MMGBSA analyses

The development of vaccines against C. koseri is particularly important given its emergence as a nosocomial pathogen with increasing antibiotic resistance and its capacity to cause severe infections in neonates and immunocompromised patients with mortality rates of 30-48% .

What biosafety and regulatory considerations apply to research with recombinant C. koseri frdC?

Research with recombinant C. koseri frdC involves several important biosafety and regulatory considerations:

  • Biosafety Classification:

    • Citrobacter species, including C. koseri, are generally classified as Biosafety Level 2 (BSL-2) organisms

    • Work must be conducted in appropriate containment facilities with proper personal protective equipment

  • Recombinant DNA Regulations:

    • All research using recombinant DNA materials, regardless of funding source, must comply with institutional and national guidelines

    • In the United States, research must follow NIH Guidelines for Recombinant DNA Research

  • Registration Requirements:

    • Non-exempt research with recombinant materials must be registered with the Institutional Biosafety Committee (IBC) before initiation

    • This includes work with recombinant proteins obtained from other scientists or commercial sources

  • Risk Assessment:

    • A formal risk assessment should be conducted, particularly considering that C. koseri can cause serious infections in neonates and immunocompromised individuals

    • The assessment should consider containment measures, emergency response procedures, and decontamination protocols

  • Reporting Requirements:

    • Both exempt and non-exempt rDNA materials are subject to reporting requirements in the event of loss, theft, release, or human exposure

    • Researchers must report incidents to their institutional biosafety office

  • Special Considerations:

    • If the recombinant research involves toxin molecules, additional review and approval processes may apply

    • Experiments with genes coding for functional recombinant toxin molecules may require registration with the NIH Office of Science Policy

These regulations ensure that research with recombinant C. koseri proteins, including frdC, is conducted safely and responsibly, minimizing risks to laboratory personnel, the public, and the environment.

What are the common technical challenges in working with recombinant frdC and how can they be addressed?

Researchers working with recombinant frdC face several technical challenges inherent to membrane proteins:

  • Protein Solubility and Stability Issues:

    • Challenge: As a hydrophobic membrane protein, frdC has poor solubility in aqueous solutions

    • Solution: Optimize detergent selection and concentration (e.g., DDM, LDAO); consider fusion tags that enhance solubility like MBP or SUMO; use specialized membrane protein expression systems

  • Low Expression Yields:

    • Challenge: Membrane proteins often express at low levels and can be toxic to host cells

    • Solution: Use tightly regulated expression systems; lower induction temperatures (16-25°C); test multiple E. coli strains (C41/C43 specifically designed for membrane proteins); consider codon optimization for the expression host

  • Proper Membrane Integration:

    • Challenge: Ensuring correct folding and membrane insertion

    • Solution: Co-express with chaperones; use E. coli strains with enhanced membrane protein expression capabilities; consider cell-free expression systems with supplied lipids or nanodiscs

  • Purification Difficulties:

    • Challenge: Maintaining stability during extraction and purification

    • Solution: Develop optimized purification protocols with appropriate detergents; consider on-column detergent exchange; use lipid-detergent mixed micelles; purify at 4°C to minimize degradation

  • Functional Assessment:

    • Challenge: Validating that the recombinant protein maintains native activity

    • Solution: Develop robust activity assays; consider reconstitution into liposomes or nanodiscs for functional studies; use comparative assays with native membrane preparations

  • Protein Aggregation:

    • Challenge: Tendency to aggregate during concentration or storage

    • Solution: Store in the presence of stabilizing agents (glycerol, specific lipids); avoid freeze-thaw cycles; optimize buffer conditions (pH, salt concentration); consider storage in detergent micelles

A systematic approach to addressing these challenges involves incremental optimization of each step in the expression and purification pipeline, with careful monitoring of protein quality and activity throughout the process.

How does frdC contribute to the pathogenicity and virulence mechanisms of C. koseri?

While frdC's direct role in pathogenicity has not been fully characterized, several aspects of C. koseri virulence mechanisms provide context for understanding how this protein might contribute:

  • Metabolic Adaptation During Infection:

    • As part of the fumarate reductase complex, frdC enables anaerobic respiration using fumarate as a terminal electron acceptor

    • This metabolic flexibility may be crucial for survival in oxygen-limited environments during infection, such as in biofilms or abscesses

    • The ability to grow under anaerobic conditions could contribute to persistence in host tissues

  • Connection to Iron Acquisition Systems:

    • C. koseri contains a High Pathogenicity Island (HPI) gene cluster that enables iron uptake in iron-deficient environments

    • Experimental deletion of this HPI cluster significantly decreased C. koseri virulence in both mouse and rat models

    • While frdC is not directly part of the HPI cluster, metabolic adaptation through anaerobic respiration may work synergistically with iron acquisition systems

  • Potential Role in Biofilm Formation:

    • T6SS-2 genes in C. koseri have been associated with colonization, survival, and invasion

    • Metabolic proteins like frdC may support the energy requirements for biofilm formation and maintenance

    • Animal studies have shown that C. koseri has a particular ability to replicate in the central nervous system, forming brain abscesses

  • Animal Model Evidence:

    • In both mouse and rat models, C. koseri demonstrates a remarkable ability to cause meningitis and brain abscesses

    • In 18-day-old BALB/c mice, bacterial counts in cerebral spinal fluid (CSF) reach significantly higher levels than in blood within 24 hours post-infection

    • In 2-day-old SD rat models, C. koseri showed a 500-fold increase in CSF compared to only a 100-fold increase in blood

Future research could specifically investigate frdC's role in these processes through targeted gene knockout studies and complementation experiments to determine its specific contribution to virulence and tissue tropism.

What comparative genomic insights can be gained from studying frdC across different Citrobacter species?

Comparative genomic analysis of frdC across Citrobacter species provides valuable insights into evolution, function, and potential therapeutic targets:

  • Phylogenetic and Evolutionary Patterns:

    • Whole genome sequencing of 129 Citrobacter isolates has classified them into 11 distinct groups, with all C. koseri strains clustering into a single group (Group 8)

    • This classification enables precise mapping of frdC sequence variations across evolutionary lineages

    • Analysis of core genome single-nucleotide polymorphisms (SNPs) can reveal selective pressures acting on metabolic genes like frdC

  • Structure-Function Relationships:

    • Comparison of frdC sequences across species may reveal conserved domains essential for function versus variable regions that might confer species-specific adaptations

    • These insights can inform structure-based drug design targeting conserved functional regions

  • Host Adaptation Signatures:

    • Different Citrobacter species show varying host preferences and tissue tropism

    • Comparative analysis of metabolic genes like frdC might reveal adaptations specific to particular niches

    • For example, C. koseri's brain tropism compared to other Citrobacter species may involve metabolic adaptations in which frdC plays a role

  • Resistance Mechanism Insights:

    • C. freundii is considered less susceptible than C. koseri to several antibiotics

    • Comparative analysis of metabolic proteins like frdC could reveal how variations contribute to different metabolic states that affect antibiotic susceptibility

    • Statistical analysis has shown a highly significant difference (p < 0.001) in antimicrobial resistance between hospital and outdoor isolates of Citrobacter species

  • Virulence Factor Distribution:

    • Systematic comparative genomic analyses have mapped the distribution of virulence factors, resistance genes, and macromolecular secretion systems among Citrobacter species

    • This approach could be extended to analyzing how frdC variants correlate with virulence profiles

A comprehensive understanding of these genomic patterns could lead to improved diagnostic tools, more effective antimicrobial strategies, and better clinical management of Citrobacter infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.