Recombinant Citrobacter koseri Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Description

Introduction

Citrobacter koseri is a Gram-negative bacterium known to cause infections, particularly in individuals with compromised immune systems . It is commonly associated with urinary tract infections and has shown increasing resistance to antibiotics, making the development of effective treatments and preventative measures crucial . One potential area of research involves understanding the bacterium's metabolic pathways and the enzymes involved, such as fumarate reductase . Fumarate reductase is an enzyme crucial for anaerobic respiration in bacteria, allowing them to survive and thrive in low-oxygen environments .

This article focuses on the subunit D (FrdD) of the recombinant Citrobacter koseri fumarate reductase. FrdD is a component of the fumarate reductase complex, which plays a vital role in the anaerobic respiratory pathway of bacteria like C. koseri .

Fumarate Reductase: An Overview

Fumarate reductase (QFR) is an enzyme that catalyzes the reduction of fumarate to succinate, a critical step in anaerobic respiration . The enzyme complex consists of four subunits: A, B, C, and D . Subunit A contains the fumarate reduction site and a flavin adenine dinucleotide (FAD) prosthetic group, while subunit B contains iron-sulfur clusters . Subunit C consists of hydrophobic membrane-spanning segments and is the site of quinol oxidation . Subunit D, which anchors the catalytic components to the cytoplasmic membrane, contains hydrophobic alpha helices that span the membrane but does not participate in the catalytic action of the enzyme .

The general reaction catalyzed by fumarate reductase is:

fumarate + quinol → succinate + quinone

Role of FrdD Subunit

The D subunit (FrdD) of fumarate reductase is a hydrophobic protein that anchors the catalytic components of the enzyme complex to the cytoplasmic membrane . While FrdD does not directly participate in the catalytic activity of the enzyme, it is essential for the structural integrity and stability of the complex .

Citrobacter koseri and its Virulence Factors

Citrobacter koseri has several virulence factors that contribute to its pathogenicity. These include flagellar apparatus biosynthesis and iron uptake mechanisms . C. koseri possesses a High Pathogenicity Island (HPI) gene cluster, similar to that found in highly pathogenic Yersinia strains, which enables iron uptake in iron-deficient environments . The bacterium's ability to colonize and persist within the host is also influenced by Type VI secretion system (T6SS) genes, which are involved in biofilm formation, colonization, survival, and antibacterial activity .

Fumarate Reductase in Citrobacter koseri

Fumarate reductase allows C. koseri to generate energy under anaerobic conditions . In E. coli, fumarate reductase is crucial for energy production when aerobic respiration or fermentation is not feasible . Its function is regulated by oxygen levels, fumarate concentrations, and the presence of other electron acceptors .

Potential as a Drug Target

Given the increasing antibiotic resistance of C. koseri, targeting essential enzymes like fumarate reductase could offer a novel approach to combatting these infections . Inhibiting fumarate reductase would disrupt the bacterium's ability to generate energy anaerobically, potentially limiting its growth and virulence . Antibiotics, including Chalcones, have been shown to inhibit fumarate reductase in E. coli .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for your application.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
frdD; CKO_03681; Fumarate reductase subunit D; Fumarate reductase 13 kDa hydrophobic protein; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Target Names
frdD
Target Protein Sequence
MINPNPKRSDEPVFWGLFGAGGMWGAIIAPVMVLLVGILLPLGLFPGDALSYERVLAFAQ SFIGRAFLFLMIVLPLWCGLHRMHHAMHDLKIHVPSGKWVFYGLAAILTVVTAIGILTI
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is utilized in anaerobic growth, while succinate dehydrogenase functions in aerobic growth. FrdD anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of fumarate reductase subunit D in Citrobacter koseri?

Fumarate reductase subunit D (FrdD) in C. koseri functions as a membrane anchor protein that helps localize the entire fumarate reductase complex to the cytoplasmic membrane. Similar to what has been observed in E. coli, C. koseri FrdD works together with FrdC to form the membrane-bound portion of the enzyme, while FrdA and FrdB form the catalytic domain extending into the cytoplasm . The FrdD subunit contains transmembrane helices that stabilize the enzyme complex within the membrane, ensuring proper positioning for electron transfer processes during anaerobic respiration when fumarate serves as the terminal electron acceptor . This positioning is critical for the enzyme's ability to couple the reduction of fumarate to succinate with the oxidation of menaquinol in the membrane, thereby contributing to the proton motive force and ATP generation under anaerobic conditions.

How does C. koseri fumarate reductase differ from succinate dehydrogenase?

C. koseri, like E. coli, possesses two distinct enzymes that catalyze the interconversion of succinate and fumarate but are optimized for opposite directions. Fumarate reductase (FRD) is adapted for the reductive reaction (fumarate → succinate) and predominates under anaerobic conditions, while succinate dehydrogenase (SDH) catalyzes the oxidative reaction (succinate → fumarate) during aerobic metabolism as part of the tricarboxylic acid cycle .

Key differences include:

  • Expression patterns: FRD is repressed under aerobic conditions but induced anaerobically, while SDH shows the opposite pattern, being completely repressed under anaerobic conditions .

  • Catalytic efficiency: While both enzymes can technically catalyze the reaction in either direction, FRD has significantly higher catalytic efficiency for fumarate reduction, making it more effective as a terminal electron acceptor during anaerobic growth .

  • Genetic regulation: The expression of FRD genes (including frdD) is controlled by anaerobic regulatory systems, particularly the FNR (fumarate and nitrate reduction) regulator that senses oxygen levels .

  • Electron carriers: FRD typically accepts electrons from menaquinol, while SDH transfers electrons to ubiquinone during aerobic respiration.

What is the genomic context of the frdD gene in C. koseri?

In C. koseri, the frdD gene is part of the frdABCD operon that encodes all four subunits of the fumarate reductase enzyme. Based on comparative genomic analysis, this operon is likely located at approximately the same position as in related Enterobacteriaceae (around 82 minutes on the chromosome in E. coli) . The gene order in the operon is typically conserved, with frdA encoding the flavoprotein subunit, frdB encoding the iron-sulfur protein, and frdC and frdD encoding the membrane anchor proteins.

Genomic analysis of multiple C. koseri strains indicates that the frd operon is part of the core genome shared among all C. koseri isolates, as it was detected among the 1450 gene families that constitute the core genome of the Citrobacter genus . The operon is likely classified within functional categories related to energy production and conversion, as well as inorganic ion transport and metabolism based on COG (Clusters of Orthologous Groups) analysis .

What are the optimal conditions for expressing recombinant C. koseri FrdD in E. coli?

Expressing recombinant C. koseri FrdD requires careful optimization due to its hydrophobic nature as a membrane protein. Based on experimental design principles for protein production, the following conditions are recommended:

Expression System Design:

ParameterOptimal ConditionRationale
Host strainE. coli C41(DE3) or C43(DE3)Specialized for membrane protein expression
VectorpET28a with C-terminal His-tagAllows purification while minimizing interference with membrane insertion
Induction0.1-0.5 mM IPTG at OD600 of 0.6-0.8Lower IPTG concentrations prevent toxic accumulation
Growth temperature18-20°C post-inductionSlows expression to allow proper membrane insertion
MediaTB or 2xYT with 0.5% glucoseRich media supports membrane protein production
Growth conditionsMicroaerobic to anaerobicMimics natural expression conditions

For optimal results, a Design of Experiments (DoE) approach is recommended to systematically test these parameters . Using a factorial design as shown in Figure 1.6 of the DoE handbook, researchers should vary key parameters (temperature, IPTG concentration, and harvest time) to identify the conditions that maximize functional protein yield while minimizing the formation of inclusion bodies .

When co-expressing all four subunits (FrdABCD), it's essential to maintain the natural stoichiometry, potentially using a polycistronic construct that preserves the operon structure. Alternatively, the C. koseri frdD gene can be expressed alone, but proper folding may require membrane-mimicking environments during purification.

What purification strategies are most effective for recombinant C. koseri FrdD?

Purifying recombinant C. koseri FrdD presents challenges due to its hydrophobic nature and membrane integration. A systematic purification workflow is recommended:

Step-by-Step Purification Protocol:

  • Membrane Isolation:

    • Harvest cells by centrifugation (5,000 × g, 15 min, 4°C)

    • Resuspend in buffer (50 mM Tris-HCl pH 8.0, 200 mM NaCl, 10% glycerol)

    • Disrupt cells via sonication or French press

    • Remove unbroken cells and debris (10,000 × g, 20 min, 4°C)

    • Ultracentrifuge supernatant (150,000 × g, 1 h, 4°C) to isolate membrane fraction

  • Membrane Protein Solubilization:

    • Resuspend membrane pellet in solubilization buffer containing:

    Detergent OptionsWorking ConcentrationBest For
    n-Dodecyl-β-D-maltoside (DDM)1-2%Initial screening
    Lauryl maltose neopentyl glycol (LMNG)0.5-1%Better stability
    Digitonin0.5-1%Native-like environment
    • Stir gently for 1-2 hours at 4°C

    • Ultracentrifuge (150,000 × g, 30 min, 4°C) to remove insoluble material

  • Affinity Purification:

    • Apply solubilized material to Ni-NTA or TALON resin

    • Use gravity flow or FPLC

    • Wash with 10-20 column volumes containing 20-40 mM imidazole

    • Elute with 250-300 mM imidazole

  • Size Exclusion Chromatography:

    • Apply concentrated sample to Superdex 200 column

    • Elute with buffer containing 0.02-0.05% detergent

Using a DoE approach to optimize the purification conditions is highly recommended . This would involve systematically testing combinations of detergents, salt concentrations, and pH values to maximize protein yield, purity, and stability. Maintain detergent concentrations above critical micelle concentration (CMC) throughout all purification steps to prevent protein aggregation.

How can I verify the structural integrity of purified recombinant FrdD?

Verifying the structural integrity of recombinant C. koseri FrdD requires multiple complementary techniques:

Structural Assessment Methods:

  • SDS-PAGE and Western Blotting:

    • Run samples under both reducing and non-reducing conditions

    • Look for expected molecular weight (~15 kDa for FrdD)

    • Confirm identity using anti-His tag or specific antibodies

  • Circular Dichroism (CD) Spectroscopy:

    • Analyze secondary structure content (expect high α-helical content)

    • Typical spectrum should show negative peaks at 208 and 222 nm

    • Compare with published CD spectra of membrane proteins with similar topology

  • Proteoliposome Reconstitution:

    • Incorporate purified FrdD into liposomes (E. coli polar lipids)

    • Assess membrane integration using flotation assays

    • Measure orientation using protease accessibility tests

  • Thermal Stability Assays:

    • Use differential scanning fluorimetry with membrane protein-compatible dyes

    • Test stability in different detergents and buffer conditions

  • Functional Association Tests:

    • Assess ability to form complex with other Frd subunits

    • Measure interaction with FrdC using pull-down assays

For comprehensive structural validation, record data in a structured format:

MethodExpected ResultInterpretation
SDS-PAGESingle band at ~15 kDaCorrect size, good purity
Western blotSpecific signal at ~15 kDaConfirmed identity
CD spectroscopyHigh α-helical contentProper secondary structure
Thermal stabilityTm > 40°CStable folded protein
Complex formationCo-purification with FrdCFunctional interactions

Incorporate appropriate controls in each experiment, such as known membrane proteins with similar characteristics and denatured samples for comparison.

What are the structural differences between C. koseri FrdD and homologous proteins in other bacterial species?

C. koseri FrdD shares structural similarities with homologous membrane anchor subunits in other bacterial species, but with key differences that may impact function and stability:

Comparative Structural Analysis:

FeatureC. koseri FrdDE. coli FrdDOther EnterobacteriaceaeNon-Enterobacteriaceae
Size~13-15 kDa~15 kDaSimilar (13-15 kDa)Variable (12-18 kDa)
TMH prediction3 TMHs3 TMHsTypically 3 TMHs2-4 TMHs
Conserved residuesHaem-coordinating residuesWell-characterizedHighly conservedMore variable
Quinone bindingMenaquinone preferenceMenaquinone preferenceMostly menaquinoneSpecies-dependent

While the primary sequence of C. koseri FrdD shows high similarity to E. coli FrdD (expected >70% identity), the subtle differences in amino acid composition, particularly in the transmembrane helices, may affect:

  • Membrane insertion efficiency: Variations in hydrophobic residues can impact how efficiently the protein integrates into the membrane

  • Interaction with FrdC: The interface between FrdD and FrdC may contain species-specific residues that optimize complex stability

  • Quinone binding site properties: The exact positioning of aromatic and charged residues near the quinone binding site can alter substrate specificity and reaction kinetics

For researchers studying these differences, homology modeling based on the crystal structure of E. coli fumarate reductase (PDB: 1KF6) is recommended as a starting point. Key regions to analyze include the transmembrane helices and the interface with FrdC. Site-directed mutagenesis of divergent residues can help identify those critical for C. koseri-specific functions.

How does the anaerobic regulation of C. koseri frdD compare to other Citrobacter species?

The regulation of fumarate reductase genes, including frdD, under anaerobic conditions shows both conservation and variation across Citrobacter species:

Comparative Regulatory Analysis:

Based on comparative genomic analysis of Citrobacter species , several key patterns emerge regarding frdD regulation:

  • Core regulatory elements: All Citrobacter species likely share conserved FNR (fumarate and nitrate reduction) binding sites in the frd operon promoter region, which respond to oxygen limitation.

  • Species-specific variations: Genomic comparison of 11 distinct Citrobacter groups reveals variations in secondary regulatory elements:

    Citrobacter GroupRegulatory FeaturesAnaerobic Expression Level
    C. koseri (Group 8)Strong FNR consensus sitesHigh expression
    C. freundiiSimilar but with sequence variationsModerate expression
    Other Citrobacter speciesMore variable FNR sitesVariable expression
  • Integration with metabolism: C. koseri appears to have tighter integration between anaerobic gene regulation and central metabolism, particularly related to inorganic ion transport and metabolism (category P) based on COG analysis . This suggests that C. koseri may coordinate fumarate reductase expression with other metabolic pathways more effectively than other Citrobacter species.

For experimental verification of these differences, researchers should consider:

  • Comparative promoter reporter assays using frdD promoters from different Citrobacter species

  • ChIP-seq analysis to identify the complete regulon of FNR across Citrobacter species

  • Transcriptomic profiling under identical anaerobic conditions to quantify expression differences

The tight regulation of anaerobic genes, including frdD, may contribute to C. koseri's unique pathogenicity profile compared to other Citrobacter species . Understanding these regulatory differences could provide insights into the ecological and pathogenic niches of different Citrobacter species.

What are common challenges when working with recombinant C. koseri FrdD and how can they be overcome?

Working with recombinant C. koseri FrdD presents several challenges typical of membrane proteins, with specific solutions:

Challenge 1: Low expression yield

  • Symptoms: Minimal protein detected by Western blot despite confirmed DNA sequence

  • Solutions:

    • Optimize codon usage for expression host

    • Try different fusion tags (N-terminal vs. C-terminal)

    • Test specialized membrane protein expression strains (C41/C43)

    • Lower induction temperature (16-18°C)

    • Apply DoE approach to systematically test combinations of media, temperature, and inducer concentration

Challenge 2: Protein aggregation during purification

  • Symptoms: Protein precipitates during purification steps or elutes in void volume during size exclusion

  • Solutions:

    • Screen detergent panel (DDM, LMNG, digitonin, CHAPS)

    • Include glycerol (10-20%) in all buffers

    • Add lipids (0.1-0.2 mg/ml) during solubilization

    • Apply DoE strategy to identify optimal detergent/salt/pH combinations

Challenge 3: Lack of functional activity

  • Symptoms: Purified protein doesn't associate with other subunits or show functional properties

  • Solutions:

    • Co-express with FrdC for proper membrane insertion

    • Purify entire FrdABCD complex instead of individual subunits

    • Reconstitute into nanodiscs or proteoliposomes

    • Verify heme incorporation using absorption spectroscopy

Challenge 4: Inconsistent results between experiments

  • Symptoms: High variability in yield or activity between batches

  • Solutions:

    • Standardize growth phase at harvest (OD600 = 0.8-1.0)

    • Implement DoE approach to identify critical parameters affecting reproducibility

    • Create detailed protocols with specific timing for each step

    • Use internal controls to normalize between experiments

ProblemDiagnostic TestPotential SolutionExpected Outcome
Low expressionWestern blotTest expression in C41(DE3)2-3× improved yield
AggregationSize exclusionTry LMNG detergentMonodisperse peak
InactivityComplex formationCo-express FrdABCDFunctional complex
VariabilitySDS-PAGE analysisStandardize protocolsCV < 15% between runs

When applying DoE principles to troubleshooting, create a formal experimental design that systematically varies key parameters rather than changing one factor at a time . This approach more efficiently identifies optimal conditions and reveals interaction effects between parameters.

How can I design a robust experiment to measure the enzymatic activity of recombinant C. koseri fumarate reductase?

Designing robust assays for C. koseri fumarate reductase requires careful consideration of both the reaction conditions and control experiments:

Enzymatic Activity Assay Design:

Method 1: Spectrophotometric Assay

  • Principle: Monitor the oxidation of reduced benzyl viologen (electron donor) coupled to fumarate reduction

  • Protocol:

    • Prepare anaerobic buffer (100 mM potassium phosphate, pH 7.4)

    • Add benzyl viologen (0.2 mM final)

    • Reduce with small amounts of sodium dithionite until A578 = 1.0-1.2

    • Add purified enzyme or membrane preparation

    • Initiate reaction with fumarate (1 mM final)

    • Monitor decrease in A578 at 30°C

Method 2: HPLC-Based Assay

  • Principle: Directly measure succinate formation from fumarate

  • Protocol:

    • Conduct reaction in anaerobic buffer with menaquinol analog (50 μM) as electron donor

    • Incubate with enzyme at 30°C for defined time periods

    • Quench reaction with perchloric acid

    • Analyze by HPLC with UV detection at 210 nm

    • Quantify succinate using standard curve

DoE-Based Optimization:
Apply factorial design to optimize key parameters :

FactorLow LevelCenter PointHigh Level
pH6.87.48.0
Temperature25°C30°C37°C
Ionic strength50 mM100 mM150 mM
Fumarate0.5 mM1.0 mM2.0 mM

Analyze results using response surface methodology to identify optimal conditions and understand interaction effects .

Critical Controls:

  • Heat-inactivated enzyme (100°C, 10 min)

  • Reaction without fumarate

  • Reaction without electron donor

  • Known concentration of E. coli fumarate reductase

  • C. koseri frdD mutant membranes

Data Analysis:

  • Calculate initial rates from linear portion of progress curves

  • Determine Km and Vmax using non-linear regression

  • Compare activities using normalized turnover numbers (kcat)

  • Report specific activity as μmol succinate produced/min/mg protein

This comprehensive approach ensures reliable, reproducible measurements of fumarate reductase activity while accounting for potential artifacts and interfering reactions.

How should I interpret conflicting data about C. koseri FrdD function from different experimental approaches?

When faced with conflicting data about C. koseri FrdD function from different experimental approaches, a systematic analysis framework helps resolve discrepancies:

Step 1: Assess methodological differences

Create a comparison table of all experimental approaches:

MethodPrincipleAdvantagesLimitationsPotential Artifacts
In vitro enzyme assaysDirect measurement of catalytic activityQuantitative kineticsArtificial conditionsDetergent effects
Genetic complementationFunctional replacement in vivoBiological relevanceIndirect measureCompensatory mutations
Protein-protein interactionPhysical association detectionDirect molecular evidenceMay not reflect in vivoNon-specific binding
Structural analysisAtomic-level informationMechanistic insightsStatic snapshotsCrystal packing artifacts
Computational predictionIn silico modelingHypothesis generationRequires validationModel limitations

Step 2: Evaluate experimental conditions

Differences in experimental conditions can cause apparently conflicting results:

  • Expression systems: Heterologous vs. homologous expression

  • Protein preparation: Detergent selection, purification methods

  • Assay conditions: pH, temperature, buffer components

  • Genetic background: Wild-type vs. various mutant strains

Step 3: Apply DoE principles to resolve conflicts

Use a DoE approach to systematically test hypotheses that might explain discrepancies :

  • Define objective: Identify conditions where conflicting results converge

  • Select factors: Choose 3-5 key variables that differ between conflicting studies

  • Design experiment: Create factorial design testing combinations of factors

  • Analyze results: Identify factors that determine when each result is observed

Step 4: Statistical analysis framework

Apply appropriate statistical tools:

  • Meta-analysis: If multiple studies exist, perform formal meta-analysis

  • Uncertainty calculation: Report confidence intervals, not just point estimates

  • Bayesian approach: Update confidence in hypotheses based on all available evidence

Case Example: Resolving FrdD function conflicts

Consider conflicting data where genetic studies suggest FrdD is essential for fumarate reductase function, but in vitro studies show activity without FrdD:

Analysis ElementFindingInterpretation
Protein stabilityFrdABC unstable without FrdD in vivoFrdD required for stability in cellular environment
In vitro conditionsDetergents stabilize FrdABC in absence of FrdDArtificial stabilization explains in vitro activity
Activity levelsActivity without FrdD is 5% of complete complexResidual activity is detectable but not physiologically relevant
Membrane potentialFrdD required for proper orientation relative to membrane potentialFunction depends on cellular context

By applying this systematic approach, researchers can transform apparent conflicts into deeper mechanistic insights about context-dependent protein function.

What are promising research avenues for studying C. koseri FrdD in pathogenesis models?

Several innovative research directions show particular promise for understanding C. koseri FrdD's role in pathogenesis:

Animal Infection Models with Tissue-Specific Oxygen Monitoring

Building on established C. koseri infection models in neonatal rats and mice , researchers should integrate real-time oxygen monitoring to correlate FrdD activity with specific microenvironments:

  • Approach: Implant oxygen-sensitive microprobes in tissues during infection

  • Measurements: Correlate bacterial loads with oxygen gradients

  • Comparison: frdD mutants vs. wild-type in oxygen-variable niches

  • Hypothesis: FrdD contribution will be most significant in tissues with fluctuating oxygen levels

Single-Cell Transcriptomics During Infection

  • Technology: Dual RNA-seq of host and pathogen from infected tissues

  • Focus: Track frdD expression at single-cell resolution during infection progression

  • Analysis: Correlate with expression of other virulence factors and host immune responses

  • Expected insight: Identification of infection stages where FrdD is most critical

CRISPR Interference Modulation During Infection

  • System: Inducible CRISPRi targeting frdD during different infection phases

  • Advantage: Temporal control of gene silencing without genetic disruption

  • Measurements: Changes in tissue tropism, bacterial persistence, and host response

  • Hypothesis: FrdD importance varies during infection progression

Comparative Pathogenesis with Multiple Citrobacter Species

The genomic analysis revealing 11 distinct Citrobacter groups provides opportunity for comparative virulence studies:

Citrobacter GroupFrdD CharacteristicsExpected Pathogenesis Impact
C. koseri (Group 8)Highly conserved sequenceStrong correlation with brain tropism
C. freundiiSequence variationsReduced neurotropism
Other Citrobacter speciesGreater sequence divergenceDifferent tissue specificity

This comparative approach could reveal whether FrdD sequence variations contribute to the unique pathogenicity profile of C. koseri, particularly its tropism for brain tissue .

Integration with Other Virulence Determinants

Given the identification of the High-Pathogenicity Island (HPI) as important for C. koseri virulence , investigating potential functional interactions between FrdD-mediated anaerobic adaptation and HPI-encoded functions could reveal synergistic virulence mechanisms:

  • Experimental approach: Generate double mutants (ΔHPI ΔfrdD)

  • Analysis: Transcriptomic profiling under infection-mimicking conditions

  • Expected outcome: Identification of coordinated virulence networks

These research directions would significantly advance understanding of how metabolic adaptation through FrdD contributes to C. koseri's distinctive pathogenesis.

How might structural biology approaches advance our understanding of C. koseri FrdD function?

Advanced structural biology techniques offer powerful approaches to elucidate C. koseri FrdD function at the molecular level:

Cryo-Electron Microscopy (Cryo-EM) of the Complete Fumarate Reductase Complex

Cryo-EM provides advantages for membrane protein complexes like fumarate reductase:

  • Sample preparation: Purify intact FrdABCD complex in nanodiscs or amphipols

  • Data collection: High-resolution imaging (aim for <3Å resolution)

  • Analysis focus:

    • FrdD positioning relative to membrane plane

    • Interface between FrdD and FrdC

    • Conformational changes during catalytic cycle

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS)

HDX-MS can reveal dynamics and conformational changes:

  • Experimental design: Compare deuterium uptake in:

    • Isolated FrdD vs. complete complex

    • Different redox states

    • Various substrate/inhibitor-bound states

  • Expected insights: Identification of flexible regions and conformational changes during catalysis

Solid-State NMR of Membrane-Embedded FrdD

Solid-state NMR is particularly suitable for membrane proteins:

  • Sample preparation: 13C/15N-labeled FrdD in lipid bilayers

  • Measurements:

    • Chemical shift assignments

    • Distance constraints

    • Orientation of transmembrane helices

  • Analysis: Generate atomic model of membrane-embedded conformation

Integrative Structural Biology Approach

Combining multiple techniques enhances structural understanding:

Structure-Guided Functional Studies

Once structural information is obtained, targeted functional studies can reveal mechanism:

  • Site-directed mutagenesis: Target residues identified in structures

  • Cross-linking studies: Validate protein-protein interfaces

  • Molecular dynamics simulations: Model membrane interaction and conformational changes

These structural approaches would provide unprecedented insights into how FrdD contributes to fumarate reductase function in C. koseri, potentially revealing species-specific features that could explain C. koseri's unique metabolic adaptation during pathogenesis.

What computational approaches can predict interaction partners and regulatory networks involving C. koseri FrdD?

Advanced computational methods offer powerful tools for predicting FrdD interactions and regulatory networks:

Protein-Protein Interaction Network Prediction

Multiple computational approaches can predict the interaction network around FrdD:

  • Co-evolution analysis using methods like Direct Coupling Analysis (DCA):

    • Identifies residue pairs that co-evolve across species

    • Can predict protein-protein interaction interfaces

    • Apply to FrdD and potential partners in C. koseri genome

  • Machine learning models trained on known bacterial interactomes:

    • Feature extraction from sequence and structure

    • Prediction of novel interaction partners

    • Ranking of most likely biologically relevant interactions

Expected FrdD Interaction Network:

Predicted PartnerInteraction ConfidenceBiological FunctionExperimental Validation Method
FrdCVery High (>95%)Membrane anchor complexPull-down assays
FrdBMedium (50-70%)Electron transferCross-linking
Respiratory complexesMedium (40-60%)Electron transfer chainMembrane co-localization
Membrane lipidsHigh (70-80%)Membrane organizationLipid binding assays

Regulatory Network Inference

Computational approaches to predict the regulatory network controlling frdD expression:

  • Promoter analysis:

    • Identify transcription factor binding sites upstream of frdABCD

    • Compare with known binding motifs (FNR, ArcA, NarL)

    • Predict strength of regulation under different conditions

  • Transcriptome data mining:

    • Analyze publicly available RNA-seq data from Citrobacter species

    • Identify genes co-regulated with frdABCD

    • Construct condition-specific regulatory networks

Metabolic Modeling and Flux Analysis

Integration of FrdD function into genome-scale metabolic models:

  • Constraint-based modeling (Flux Balance Analysis):

    • Incorporate fumarate reductase reaction constraints

    • Predict metabolic flux changes under anaerobic conditions

    • Simulate impact of frdD mutations on cellular energetics

  • Comparative metabolic modeling across Citrobacter species:

    • Identify differences in anaerobic metabolism

    • Predict species-specific metabolic capabilities

    • Relate to pathogenic potential

Evolutionary Analysis and Selection Pressure

  • Selection pressure analysis:

    • Calculate dN/dS ratios across frdD sequences

    • Identify residues under positive selection

    • Correlate with predicted functional regions

  • Horizontal gene transfer detection:

    • Analyze genomic context conservation

    • Identify potential mobile genetic elements

    • Assess evolutionary history of frdABCD operon

Multi-scale Modeling

Integration of molecular and systems-level models:

  • Molecular dynamics of FrdD in membrane environment

  • Link to metabolic models through kinetic parameters

  • Predict system-level impact of mutations or inhibitors

These computational approaches would generate testable hypotheses about FrdD function and regulation, guiding experimental design and providing a systems-level understanding of how this protein contributes to C. koseri metabolism and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.