Recombinant Citrobacter koseri Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; CKO_04703; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-136
Protein Length
full length protein
Species
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Target Names
mscL
Target Protein Sequence
MSFIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAFT LREAQGDIPAVVMHYGVFIQNVFDFVIVAFAIFMAIKLINKLNRKKEEPTEAPAPTTEEV LLSEIRDLLKEQNNRS
Uniprot No.

Target Background

Function

A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.

Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Citrobacter koseri MscL protein and what is its biological significance?

The MscL (Large-conductance mechanosensitive channel) protein in Citrobacter koseri is a membrane protein involved in mechanosensation, specifically transducing membrane stress into electrochemical responses. This protein belongs to a family of mechanosensitive channels found across various bacterial species, with the Escherichia coli and Mycobacterium tuberculosis homologs being the most extensively characterized . In bacteria, these channels function as emergency release valves that open in response to increased membrane tension, preventing cell lysis during osmotic downshock. The C. koseri MscL protein consists of 136 amino acids and plays a crucial role in bacterial survival under changing osmotic conditions .

How is recombinant C. koseri MscL typically expressed and purified for research applications?

Recombinant C. koseri MscL is typically expressed in E. coli expression systems using vectors like pET-28a(+) that introduce an N-terminal His-tag to facilitate purification . The standard protocol involves:

  • Cloning the mscL gene (136 amino acids in full length) into an expression vector

  • Transformation into an E. coli expression strain

  • Induction of protein expression, typically with IPTG

  • Cell lysis using mechanical disruption or detergent-based methods

  • Purification via nickel affinity chromatography using the His-tag

  • Optional secondary purification steps (size exclusion chromatography)

  • Storage in appropriate buffer conditions with potential addition of glycerol (5-50%) to prevent freeze-thaw damage

The purified protein is generally obtained at >90% purity as determined by SDS-PAGE and can be stored as lyophilized powder or in solution with glycerol at -20°C or -80°C .

How can recombinant C. koseri MscL be used to study bacterial mechanosensation mechanisms?

Recombinant C. koseri MscL can be employed in multiple advanced experimental setups to understand bacterial mechanosensation:

  • Patch-clamp electrophysiology: After reconstituting purified MscL into liposomes or planar lipid bilayers, researchers can directly measure channel gating in response to membrane tension. Comparison with well-characterized homologs like E. coli MscL can reveal species-specific mechanosensing properties.

  • Fluorescence-based assays: By incorporating environment-sensitive fluorophores at specific cysteine residues (introduced through site-directed mutagenesis), conformational changes during channel gating can be monitored in real-time.

  • Molecular dynamics simulations: Using the protein sequence data and structural information from homologs , researchers can model membrane tension effects on channel conformation and gating mechanisms.

  • In vivo functional complementation: Expression of C. koseri MscL in MscL-deficient E. coli strains allows assessment of functional conservation across species by measuring osmotic shock survival rates.

These approaches collectively provide insights into how mechanical force is converted into channel opening, which represents a fundamental mechanism in bacterial environmental sensing .

What are the key differences between C. koseri MscL and other bacterial mechanosensitive channels?

Although complete comparative studies specific to C. koseri MscL are still emerging, analysis based on existing homolog research reveals:

FeatureC. koseri MscLE. coli MscLM. tuberculosis MscL
Length136 amino acids136 amino acids151 amino acids
Sequence identityReference~90% (estimated)~40% (estimated)
Channel conductanceNot fully characterized~3 nS~3 nS
Gating thresholdNot fully characterized~10-12 mN/mSimilar to E. coli
Crystal structureNot availableNot availableResolved (closed state)

The functional significance of these differences lies in potential adaptations to specific membrane environments or osmotic stress conditions encountered by C. koseri during infection. Of particular research interest is how these differences might contribute to C. koseri's pathogenic potential, especially given its association with meningitis and urinary tract infections in immunocompromised patients .

How might C. koseri MscL contribute to bacterial pathogenesis and antibiotic resistance?

The connection between MscL function and C. koseri pathogenesis represents an emerging research area with several hypotheses:

  • Osmotic stress adaptation: During infection, bacteria encounter varying osmotic environments. MscL may help C. koseri survive osmotic transitions in different host microenvironments, particularly during urinary tract infections and meningitis, where osmolarity can fluctuate .

  • Antibiotic resistance modulation: Some studies suggest mechanosensitive channels may influence antibiotic uptake or efflux. Given C. koseri's documented resistance to multiple antibiotics (Ampicillin, Cefuroxime, Ceftriaxone, and Cefepime ), investigating MscL's potential role in this resistance is warranted.

  • Biofilm formation: Mechanical forces influence bacterial biofilm formation, and mechanosensitive channels may participate in sensing surface attachment. This could contribute to C. koseri's persistence in hospital environments and medical devices.

Research methodologies to explore these connections include:

  • Creating MscL knockout mutants in C. koseri using techniques similar to those employed for high-pathogenicity island (HPI) deletion

  • Testing antibiotic susceptibility profiles in wild-type versus MscL-deficient strains

  • In vivo infection models to assess virulence differences

What experimental approaches can be used to study the structure-function relationship of C. koseri MscL?

Advanced structural biology and biophysical techniques applicable to C. koseri MscL research include:

  • Cryo-electron microscopy (cryo-EM): Enables visualization of the channel in different conformational states without crystallization, particularly valuable for membrane proteins like MscL.

  • Site-directed spin labeling coupled with electron paramagnetic resonance (EPR): Allows monitoring of site-specific conformational changes during channel gating.

  • Single-molecule FRET spectroscopy: Measures distances between labeled residues during gating, providing insights into conformational dynamics.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Identifies regions with different solvent accessibility in open versus closed states.

  • Molecular dynamics simulations: Combined with experimental data, can model how specific amino acid substitutions affect channel gating properties.

Implementing these approaches requires careful consideration of protein stability and functional integrity after reconstitution in membrane mimetics (nanodiscs, liposomes, or detergent micelles) .

What expression system optimizations are recommended for high-yield production of functional C. koseri MscL?

Several strategies can enhance recombinant C. koseri MscL expression yield and functionality:

Optimization ParameterRecommended ApproachRationale
Expression strainC41(DE3) or C43(DE3) E. coliStrains engineered for membrane protein overexpression
Induction conditions0.1-0.5 mM IPTG, 18-25°C, 16-20hLower temperatures reduce inclusion body formation
Media supplements0.5-1% glucose during growthReduces leaky expression before induction
Solubilizationn-Dodecyl-β-D-maltopyranoside (DDM)Mild detergent preserving protein functionality
Affinity purificationIMAC with step gradientReduces co-purification of contaminants
Buffer composition20 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.05% DDMMaintains stability during purification

Functional verification after purification is essential and can be performed using liposome swelling assays or planar lipid bilayer electrophysiology to confirm channel activity in response to membrane tension .

How can researchers assess the functional activity of purified recombinant C. koseri MscL?

Multiple complementary approaches allow functional characterization of purified MscL:

  • Electrophysiological Recordings: The gold standard for functional assessment involves reconstituting MscL into liposomes or planar lipid bilayers and measuring single-channel currents using patch-clamp techniques. This approach provides direct evidence of channel functionality, gating threshold, and conductance properties.

  • Fluorescence-Based Liposome Efflux Assays:

    • Reconstituting MscL into liposomes loaded with self-quenching fluorescent dyes (e.g., calcein)

    • Applying osmotic downshock or membrane-fluidizing agents

    • Measuring fluorescence increase as dye releases through functional MscL channels

  • In Vivo Complementation Assays:

    • Expressing C. koseri MscL in E. coli MscL knockout strains

    • Subjecting cells to osmotic downshock

    • Measuring survival rates compared to controls

    • Decreased survival indicates impaired MscL function

  • Circular Dichroism Spectroscopy: Verifies proper protein folding by analyzing secondary structure composition, which should show predominantly α-helical content consistent with transmembrane domains.

These methods collectively provide robust validation of both protein structure and mechanosensitive function .

What are the recommended protocols for reconstituting C. koseri MscL into membrane mimetics for functional studies?

The successful reconstitution of C. koseri MscL into membrane systems requires careful attention to lipid composition and reconstitution methodology:

Liposome Reconstitution Protocol:

  • Prepare lipid mixture (typically E. coli polar lipids or POPE:POPG 3:1)

  • Dissolve lipids in chloroform, dry under nitrogen, and resuspend in buffer

  • Solubilize lipids in detergent (same as used for protein purification)

  • Mix purified MscL with solubilized lipids at protein:lipid ratio of 1:200-1:1000 (w/w)

  • Remove detergent using Bio-Beads SM-2 or dialysis

  • Verify reconstitution by freeze-fracture electron microscopy or dynamic light scattering

Nanodisc Reconstitution:

  • Prepare MSP (membrane scaffold protein) according to established protocols

  • Mix purified MscL, MSP, and lipids at optimized ratios

  • Remove detergent using Bio-Beads SM-2

  • Purify MscL-containing nanodiscs using size exclusion chromatography

The lipid composition significantly impacts MscL function, with increased presence of negative phospholipids generally lowering the tension threshold for channel activation. Additionally, membrane thickness affects gating sensitivity, with thinner membranes facilitating channel opening at lower tension thresholds .

What are common challenges in recombinant C. koseri MscL expression and purification, and how can they be addressed?

Researchers commonly encounter several obstacles when working with recombinant MscL proteins:

ChallengePotential CausesSolutions
Low expression yieldToxicity to host cells; codon biasUse C41/C43(DE3) strains; codon optimization; tight expression control
Inclusion body formationRapid overexpression; improper foldingReduce induction temperature (18°C); use milder induction (0.1 mM IPTG)
Poor solubilizationInadequate detergentScreen detergents (DDM, LDAO, DMNG); optimize detergent:protein ratio
Aggregation during purificationDetergent concentration too low; protein instabilityMaintain detergent above CMC; add glycerol (10%); consider lipid additives
Loss of functionDelipidation during purificationAdd E. coli lipid extract during purification; minimize purification steps
Protein precipitation during storageBuffer incompatibility; freeze-thaw damageAdd 5-50% glycerol; store at -80°C in small aliquots; avoid repeated freeze-thaw cycles

For particularly challenging preparations, fusion partners like MBP (maltose-binding protein) can improve solubility, though these must typically be removed prior to functional studies to prevent interference with channel activity.

How can researchers interpret contradictory data when comparing C. koseri MscL with homologs from other bacterial species?

When faced with contradictory results between C. koseri MscL and other bacterial homologs, consider these analytical approaches:

  • Sequence-based analysis:

    • Perform multiple sequence alignments focusing on key functional residues known to affect gating in model systems

    • Identify unique residues in C. koseri MscL that may explain functional differences

    • Map divergent residues onto structural models to predict functional consequences

  • Experimental validation framework:

    • Create chimeric proteins by swapping domains between C. koseri MscL and well-characterized homologs

    • Perform systematic mutagenesis of divergent residues

    • Use consistent methodology across homologs to eliminate technical variability

  • Contextual factors to consider:

    • Natural lipid environment differences between bacterial species

    • Expression levels and regulation in native contexts

    • Interactions with other proteins or cellular components

  • Statistical robustness:

    • Increase biological and technical replicates

    • Use multiple complementary techniques to verify key findings

    • Apply appropriate statistical tests for significance assessment

Remember that apparent contradictions may reflect genuine biological differences related to C. koseri's specific ecological niche and pathogenic lifestyle rather than methodological artifacts .

What considerations are important when using C. koseri MscL as a model for studying bacterial mechanosensation in pathogenic contexts?

When applying C. koseri MscL research to understand bacterial pathogenesis, consider these critical factors:

  • Physiological relevance of experimental conditions:

    • Match membrane tension ranges to those encountered during infection

    • Consider ionic conditions representative of infection sites (CSF for meningitis models, urine for UTI models)

    • Evaluate temperature effects at both environmental (25°C) and host body temperatures (37°C)

  • Integration with C. koseri pathogenesis:

    • Correlate MscL function with virulence in infection models

    • Consider potential interactions with other virulence factors

    • Investigate potential cross-talk with high-pathogenicity island (HPI) components, as HPI deletion significantly decreases C. koseri virulence in animal models

  • Comparative approaches:

    • Include non-pathogenic control strains in experiments

    • Consider constructing hybrid strains expressing MscL variants from different sources

    • Evaluate how specific MscL properties correlate with pathogenic potential across Citrobacter species

  • Translational potential:

    • Assess MscL as a potential antibiotic target

    • Explore whether MscL function affects antibiotic susceptibility

    • Consider MscL accessibility to potential therapeutic agents

These considerations help ensure research findings accurately reflect the biological role of MscL in C. koseri pathogenesis rather than artifacts of experimental design .

How might C. koseri MscL research contribute to novel antimicrobial development?

Exploring C. koseri MscL as a potential antimicrobial target offers several promising research avenues:

  • Channel-targeting compounds:

    • Design small molecules that lock MscL in an open state, causing osmotic dysregulation

    • Develop peptides that bind to and block channel function

    • Create compounds that alter gating sensitivity, making bacteria vulnerable to environmental stresses

  • Combination therapy approaches:

    • Investigate synergistic effects between MscL modulators and existing antibiotics

    • Explore whether targeting MscL can overcome existing resistance mechanisms in C. koseri

    • Assess if MscL modulation affects biofilm formation and antibiotic penetration

  • Experimental design considerations:

    • High-throughput screening assays using fluorescence-based liposome systems

    • In silico molecular docking studies targeting key functional regions

    • Animal infection models to validate in vitro findings

    • Assessment of resistance development frequency

This research direction is particularly relevant given C. koseri's documented resistance to multiple antibiotics including Ampicillin, Cefuroxime, Ceftriaxone, and Cefepime , highlighting the need for novel therapeutic approaches against this opportunistic pathogen.

What genomic and proteomic approaches could advance our understanding of C. koseri MscL regulation and function?

Integrative approaches combining genomics and proteomics offer powerful tools for understanding MscL in C. koseri:

  • Transcriptomic analysis:

    • RNA-seq under various osmotic conditions and during infection

    • Identification of co-regulated genes suggesting functional networks

    • mRNA stability and translational efficiency assessment

  • Proteomic approaches:

    • Interactome mapping using proximity labeling techniques

    • Post-translational modification profiling using mass spectrometry

    • Quantitative proteomics across infection-relevant conditions

  • Comparative genomics:

    • Analysis across multiple C. koseri strains for mscL variants

    • Regulatory element identification in mscL promoter regions

    • Evolutionary analysis of mscL across the Citrobacter genus to identify selection pressures

  • Integrated data analysis:

    • Network analysis combining transcriptomic and proteomic data

    • Machine learning approaches to identify condition-specific regulatory patterns

    • Correlation analysis between mscL expression and virulence traits

These approaches could reveal how MscL regulation is integrated with broader stress responses and virulence mechanisms in C. koseri, providing a systems-level understanding beyond individual protein characterization .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.