Recombinant Citrobacter koseri NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributor.
All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
The shelf life of this product is influenced by factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type is determined during production. If you have specific tag type requirements, kindly inform us and we will prioritize developing the specified tag.
Synonyms
nuoK; CKO_00517; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Target Names
nuoK
Target Protein Sequence
MIPLQHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQV MYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, ubiquinone is believed to be the direct electron acceptor for the enzyme. This process couples the redox reaction with proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. Consequently, the redox energy is conserved in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Citrobacter koseri and why is it significant in clinical research?

Citrobacter koseri is a gram-negative, rod-shaped bacterium belonging to the Enterobacteriaceae family that has emerged as an important opportunistic pathogen. It is frequently isolated from clinical samples and has been implicated in healthcare-associated infections, particularly urinary tract infections that account for 35-40% of total healthcare infections . C. koseri is known to cause serious infections including neonatal meningitis and brain abscesses, especially in immunocompromised patients . The genus Citrobacter was discovered in 1932 by Werkman and Gillen, and these organisms are naturally found in soil, water, and the intestinal tract of animals and humans . C. koseri has gained particular attention because contamination of platelet concentrates with this bacterium has been linked to fatal transfusion reactions in France between 2012 and 2017 .

What is the NADH-quinone oxidoreductase complex and what role does the nuoK subunit play?

NADH-quinone oxidoreductase (NDH-1), also known as Complex I, is the first enzyme in the respiratory chain that catalyzes electron transfer from NADH to quinone coupled with proton pumping across the cytoplasmic or mitochondrial membrane . This process is fundamental to cellular energy production. The nuoK subunit (bacterial homologue of mitochondrial ND4L) is one of seven hydrophobic subunits in the membrane domain of NDH-1 . NuoK contains three transmembrane segments (TM1-3) and plays a crucial role in the energy coupling mechanism of the complex . Research has demonstrated that this subunit contains highly conserved glutamic acid residues that are essential for coupling electron transfer with proton translocation, making it a key component for understanding the bioenergetic mechanisms of respiratory complexes .

How does the structure of nuoK contribute to its functional role in energy transduction?

The nuoK subunit's structure is characterized by three transmembrane segments (TM1-3) that are integral to its function in energy transduction . Two glutamic acid residues located in adjacent transmembrane helices (Glu-36 in TM2 and Glu-72 in TM3) are particularly important for the energy-coupled activity of NDH-1 . Experimental evidence shows that mutation of the highly conserved Glu-36 to alanine leads to almost complete loss of coupled electron transfer activities and elimination of electrochemical gradient generation . The second conserved glutamic acid (Glu-72) also contributes to function, though mutations of this residue show more moderate effects on activity .

Additionally, a short cytoplasmic loop between TM1 and TM2 contains two arginine residues (Arg-25 and Arg-26) that significantly impact energy transduction when simultaneously mutated . The specific arrangement of these charged residues within the membrane environment creates the necessary structural elements for proton translocation, allowing nuoK to contribute to the proton-pumping activity of the entire complex .

What methods are recommended for expressing and purifying recombinant C. koseri nuoK?

To effectively study recombinant C. koseri nuoK, researchers should implement the following methodological approach:

  • Gene Cloning and Vector Selection:

    • Clone the nuoK gene from C. koseri genomic DNA using PCR amplification with high-fidelity polymerase

    • Select expression vectors compatible with membrane protein expression (pET series with T7 promoter or pBAD with arabinose-inducible promoter)

    • Consider fusion tags (His6, FLAG, or MBP) to facilitate detection and purification

  • Expression Systems:

    • Use E. coli strains optimized for membrane protein expression (C41(DE3), C43(DE3), or Lemo21(DE3))

    • Alternatively, consider homologous expression in Citrobacter species to maintain native membrane environment

  • Expression Conditions:

    • Induce at lower temperatures (16-25°C) to reduce inclusion body formation

    • Use reduced inducer concentrations for slower, more controlled expression

    • Consider adding membrane-stabilizing agents like glycerol or specific lipids

  • Membrane Extraction and Solubilization:

    • Isolate membrane fractions through differential centrifugation

    • Solubilize membranes using mild detergents (n-dodecyl-β-D-maltoside, digitonin, or amphipols)

    • Maintain pH and salt conditions that preserve protein stability

  • Purification Strategy:

    • Employ affinity chromatography based on fusion tags

    • Follow with size exclusion chromatography to remove aggregates

    • Consider ion exchange chromatography for additional purity

The validation of properly folded and functional nuoK requires specialized approaches since it is typically studied in the context of the complete NDH-1 complex rather than in isolation .

What assays are most effective for evaluating nuoK function in NDH-1 complex activity?

Several complementary assays can effectively evaluate nuoK function within the NDH-1 complex:

Table 1: Recommended Assays for nuoK Functional Analysis

Assay TypeMethodMeasurementAdvantagesLimitations
Electron TransferdNADH-K₃Fe(CN)₆ reductaseAbsorbance at 420 nmSimple, quantitativeUses artificial electron acceptor
Electron TransferdNADH-DB reductaseAbsorbance at 340 nmUses quinone analogLess physiological than natural quinones
Electron TransferdNADH-UQ₁ reductaseAbsorbance at 340 nmMore physiologically relevantLower activity than with artificial acceptors
Proton PumpingMembrane potential measurementsFluorescence of potential-sensitive dyesDirectly assesses couplingRequires intact membrane vesicles
Proton PumpingpH monitoringDirect pH measurementQuantitative assessment of proton movementTechnical complexity
Complex AssemblyBlue-native gel electrophoresisProtein complex integrityConfirms proper assemblyNot directly functional
Subunit IncorporationImmunoblottingPresence of nuoK in complexSpecific detection of nuoKRequires specific antibodies

According to research protocols, activity assays are typically performed using membrane vesicles (80 μg protein/ml) in 10 mM potassium phosphate buffer (pH 7.0) containing 1 mM EDTA and 10 mM KCN . For the dNADH-K₃Fe(CN)₆ reductase assay, 1 mM K₃Fe(CN)₆ is used as the electron acceptor, and the reaction is initiated with 150 μM dNADH after 1 minute of preincubation . Similar approaches with appropriate electron acceptors are used for the other electron transfer assays.

What site-directed mutagenesis approaches are most suitable for studying nuoK conserved residues?

Site-directed mutagenesis of nuoK conserved residues requires careful planning and execution to generate meaningful results. Based on successful experimental approaches described in the literature, the following protocol is recommended:

  • Strategic Mutation Selection:

    • Target highly conserved residues identified through sequence alignment (e.g., Glu-36, Glu-72, Arg-25/26)

    • Consider charge-conserving mutations (E→D, R→K) and charge-neutralizing mutations (E→Q, R→N)

    • Include charge-reversing mutations (E→K, R→E) to test electrostatic interactions

    • Design positional scanning mutations to test spatial requirements (e.g., shifting Glu-36 to positions 32, 38, 39, 40)

  • Technical Approach:

    • Use overlapping PCR or QuikChange methodology with high-fidelity polymerases

    • Design primers with the mutation centrally located and 15-20 nucleotides of correct sequence on each side

    • Consider the entire NDH-1 operon context for proper expression and assembly

  • Expression and Validation Strategy:

    • Express mutants in a system allowing assembly of the complete NDH-1 complex

    • Verify complex assembly using blue-native gel electrophoresis and immunostaining

    • Compare expression levels of wild-type and mutant proteins

  • Functional Assessment:

    • Systematically analyze both electron transfer and proton pumping activities

    • Compare activities with different electron acceptors to distinguish between partial defects

    • Consider temperature-dependent assays to detect subtle structural impacts

Research has shown that relocating key residues like Glu-36 along the same helical face (positions 32, 38, 39, 40) preserves activity, while moving them to different faces of the helix disrupts function . This approach provides valuable insights into the spatial requirements for nuoK function within the proton translocation pathway.

How do mutations in conserved glutamic acid residues affect the proton translocation mechanism?

The conserved glutamic acid residues in nuoK play critical but distinct roles in the proton translocation mechanism of NDH-1. Detailed mutagenesis studies have revealed the following effects:

Mutation of Glu-36 (TM2) to alanine results in:

  • Nearly complete loss of coupled electron transfer activity

  • Elimination of electrochemical gradient generation

  • Disruption of the proton translocation pathway while preserving electron transfer

Mutation of Glu-72 (TM3) shows:

  • Moderate reduction in coupled activities

  • Partial preservation of proton pumping

  • Less severe impact than Glu-36 mutations, suggesting a secondary role

These findings indicate a hierarchical importance of these residues in the coupling mechanism. The remarkable aspect is that while these glutamic acid residues are membrane-embedded, they likely function as proton donors/acceptors within the proton translocation pathway . Their carboxyl groups create an environment that facilitates proton movement against the electrochemical gradient, utilizing energy derived from electron transfer.

Relocation experiments demonstrated that Glu-36 can maintain functionality when shifted to positions 32, 38, 39, or 40 along the same helical face . This suggests that the spatial orientation of the carboxyl group within the membrane domain is more critical than its exact position, provided it remains accessible to the proton translocation pathway.

How might differences in nuoK contribute to the distinct antimicrobial susceptibility profiles of Citrobacter species?

While the search results do not directly address nuoK's role in antimicrobial susceptibility, several mechanistic connections can be reasonably proposed:

The mechanistic understanding of these relationships requires further research, particularly focused on comparing nuoK structure, expression, and function across Citrobacter species with different antimicrobial susceptibility profiles.

How does nuoK functionality relate to C. koseri virulence mechanisms?

The relationship between nuoK functionality and C. koseri virulence mechanisms involves several interconnected aspects:

  • Energy Provision for Virulence Factor Expression:
    As a component of the NDH-1 complex, nuoK contributes to energy production through the respiratory chain . This energy is essential for the expression and function of virulence factors. C. koseri possesses a high-pathogenicity island (HPI) that contributes to its virulence, particularly through iron acquisition systems . The expression and functionality of these virulence determinants require adequate energy supply.

  • Adaptation to Host Environments:
    During infection, C. koseri encounters various microenvironments with different oxygen and nutrient availabilities. Efficient energy production through respiratory complexes containing nuoK allows adaptation to these changing conditions, supporting bacterial survival and persistence during infection.

  • Metabolic Flexibility:
    The ability to maintain energy production under varying conditions may depend partially on nuoK function. This metabolic flexibility could contribute to C. koseri's ability to cause infections in diverse sites, including the urinary tract, bloodstream, and central nervous system .

  • Stress Response and Antimicrobial Resistance:
    Energy status influences bacterial stress responses, including those triggered by host defense mechanisms and antimicrobial agents. The energy transduction function of nuoK may indirectly impact the bacterium's ability to respond to these stresses and express resistance mechanisms.

While direct evidence linking nuoK specifically to virulence in C. koseri is not presented in the search results, these connections highlight the importance of energy metabolism in bacterial pathogenesis and suggest potential avenues for further research into nuoK's role in C. koseri infections.

What relationship exists between nuoK and the high-pathogenicity island in C. koseri?

Comparative genomic analysis has identified a high-pathogenicity island (HPI) in C. koseri that appears to be important for its virulence . While the search results do not establish a direct relationship between nuoK and this HPI, several potential connections can be proposed:

  • Energy Requirements for HPI Function:
    The HPI cluster in C. koseri contains genes for iron transport . Iron acquisition systems are energetically demanding, requiring ATP and/or proton motive force. The energy transduction function of nuoK as part of NDH-1 would contribute to meeting these energy requirements.

  • Regulatory Interconnections:
    Bacterial energy status often serves as a regulatory input for virulence gene expression. The activity of the NDH-1 complex containing nuoK could potentially influence regulatory pathways that control HPI gene expression.

  • Iron-Energy Metabolism Relationship:
    Iron is essential for many respiratory enzymes, including components of the electron transport chain. There may be regulatory crosstalk between iron acquisition systems in the HPI and energy metabolism involving nuoK.

  • Coordinated Expression:
    Under specific host conditions, C. koseri may coordinate the expression of both energy metabolism genes (including nuoK) and virulence factors in the HPI to optimize survival and pathogenicity.

Animal experiments have shown that loss of the HPI cluster significantly decreased C. koseri virulence in mice and rats , highlighting its importance for pathogenicity. Further research specifically investigating the relationship between nuoK function and HPI expression or activity would be valuable for understanding the integrated virulence strategies of C. koseri.

How could targeted mutations in nuoK be used to develop attenuated strains for vaccine development?

The strategic modification of nuoK could potentially create attenuated C. koseri strains suitable for vaccine development through the following approaches:

  • Energy Coupling Disruption:
    Introducing specific mutations in conserved residues like Glu-36 or the Arg-25/26 pair could partially disrupt energy coupling without preventing growth . This would create strains with reduced fitness in host environments but preserved antigenicity.

  • Conditional Attenuation Strategies:
    Designing mutations that impair nuoK function specifically under host conditions (e.g., temperature-sensitive mutations) could create strains that grow normally during vaccine production but become attenuated after administration.

  • Combining with HPI Modifications:
    Given the importance of the HPI for C. koseri virulence , combining nuoK modifications with partial HPI alterations could produce synergistically attenuated strains that retain immunogenicity.

  • Balanced Attenuation Approach:
    The ideal vaccine strain would be sufficiently attenuated to prevent disease while maintaining enough metabolic activity to express protective antigens. Careful selection of nuoK mutations that partially reduce but don't eliminate NDH-1 function could achieve this balance.

  • Safety Enhancement:
    The relatively well-understood structure-function relationships of nuoK allow for rational design of mutations with predictable effects, potentially improving the safety profile of attenuated vaccine candidates.

This approach would require careful validation in animal models to ensure appropriate balance between attenuation and immunogenicity. The existing research on nuoK mutations and their functional consequences provides a foundation for such rational vaccine design strategies.

What emerging technologies could advance our understanding of nuoK structure-function relationships?

Several cutting-edge technologies show promise for advancing our understanding of nuoK structure-function relationships:

  • Cryo-Electron Microscopy (Cryo-EM):
    Recent advances in cryo-EM resolution now allow visualization of side-chain conformations in membrane proteins. This could reveal how nuoK's critical residues (Glu-36, Glu-72, Arg-25/26) are positioned within the NDH-1 complex and how they change during the catalytic cycle.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):
    This technique can map protein dynamics and solvent accessibility, potentially revealing how mutations in nuoK affect the conformational flexibility of NDH-1 and identifying regions involved in proton pathways.

  • Single-Molecule FRET:
    Applying single-molecule Förster resonance energy transfer to strategically labeled NDH-1 complexes could capture real-time conformational changes during electron transfer and proton pumping, providing insights into how nuoK participates in these dynamics.

  • Time-Resolved Serial Crystallography:
    Using X-ray free-electron lasers to capture transient states during NDH-1 catalysis could reveal the sequence of conformational changes involving nuoK during the complete catalytic cycle.

  • Integrative Structural Biology:
    Combining complementary techniques (cryo-EM, mass spectrometry, spectroscopy, computational modeling) could provide a comprehensive view of nuoK's role within the NDH-1 complex.

  • Nanoscale Electrochemistry:
    Developing methods to measure proton movements at nanoscale resolution could directly assess how nuoK mutations affect local proton translocation events within the complex.

These technologies, applied to both wild-type and mutant forms of nuoK, would significantly advance our understanding of how this small but critical subunit contributes to the sophisticated energy transduction mechanism of Complex I.

What computational approaches might predict functional impacts of nuoK variations across Citrobacter species?

Advanced computational approaches offer powerful tools for predicting the functional impacts of nuoK variations across Citrobacter species:

  • Molecular Dynamics Simulations:

    • Long-timescale simulations of nuoK within membrane environments

    • Free energy calculations for proton transfer through different nuoK variants

    • Identification of water molecules and their dynamics in proton translocation pathways

  • Quantum Mechanics/Molecular Mechanics (QM/MM):

    • Hybrid calculations focusing on proton transfer energetics

    • Modeling of charge distribution around key residues (Glu-36, Glu-72)

    • Electronic structure analysis of proton donor/acceptor residues

  • Evolutionary Coupling Analysis:

    • Identification of co-evolving residues across Citrobacter species

    • Detection of epistatic interactions that maintain function despite sequence variation

    • Mapping of evolutionary constraints on nuoK structure

  • Machine Learning Approaches:

    • Training models on existing nuoK mutational data to predict impacts of novel variations

    • Integration of structural, evolutionary, and functional data

    • Classification of variants as neutral, deleterious, or function-altering

  • Network Analysis:

    • Modeling of residue interaction networks within nuoK and between subunits

    • Prediction of how variations might propagate effects through the protein complex

    • Identification of critical nodes for energy transduction

  • Comparative Genomics with Structural Context:

    • Mapping species-specific variations onto structural models

    • Correlating genomic differences with functional phenotypes

    • Identifying structurally constrained vs. variable regions

These computational approaches, validated against experimental data, could provide a framework for understanding how natural variations in nuoK across Citrobacter species influence energy transduction efficiency and potentially contribute to differences in metabolism, stress response, and pathogenicity.

How might cross-species comparative analysis of nuoK contribute to understanding respiratory complex evolution?

Cross-species comparative analysis of nuoK offers valuable insights into respiratory complex evolution:

  • Evolutionary Conservation Patterns:
    The high conservation of key residues like Glu-36 across diverse species suggests fundamental constraints on the proton translocation mechanism . Mapping conservation patterns onto structural models can reveal functionally critical regions versus those permissive to variation.

  • Adaptation to Ecological Niches:
    Comparing nuoK sequences from Citrobacter species found in different environments (clinical isolates versus environmental strains) could reveal adaptations to specific ecological contexts. For example, C. koseri isolated from clinical settings might show optimizations for host environments .

  • Co-evolution with Other Complex I Components:
    NuoK functions within the larger NDH-1 complex, necessitating coordinated evolution with interacting subunits. Analyzing co-evolutionary patterns between nuoK and other subunits could identify functionally coupled residues and interaction networks.

  • Horizontal Gene Transfer Assessment:
    Comparative genomic analysis can determine whether nuoK evolution follows vertical inheritance patterns or shows evidence of horizontal gene transfer events that might contribute to functional adaptation or pathogenicity in certain Citrobacter lineages.

  • Evolutionary Trajectory Mapping:
    By comparing nuoK across diverse bacterial species, including other Enterobacteriaceae and more distant relatives, researchers can reconstruct the evolutionary history of this subunit and identify key transitional forms or convergent evolutionary solutions.

  • Structure-Function Relationship Across Taxa:
    Comparative analysis of nuoK variants with known functional differences could reveal how structural variations influence bioenergetic efficiency, potentially explaining why some Citrobacter species are more effective pathogens than others .

This evolutionary perspective on nuoK provides context for understanding not only the function of this subunit in Citrobacter koseri but also broader principles of respiratory complex evolution and adaptation across bacteria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.