Recombinant Citrobacter koseri p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aaeA; CKO_04648; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Target Names
aaeA
Target Protein Sequence
MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITN VSVHDNQLVKKDQILFTIDQPRYKKALEEAEADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGS TAVALVKQHSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTR DAKGMATIDSNLEWVRLAQRVPVRIRLDDQQDNLWPAGTTATVVITGKQDRDETQDSFFR KMAHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the predicted structure and function of AaeA in Citrobacter koseri compared to its E. coli homolog?

The AaeA protein in Citrobacter koseri functions as a membrane fusion protein (MFP) component of the AaeAB efflux system. While specific structural data for C. koseri AaeA is limited, we can infer its characteristics from the well-studied E. coli homolog due to their close phylogenetic relationship within Enterobacteriaceae.

In E. coli, AaeA works in conjunction with AaeB, which belongs to the putative efflux protein (PET) family, forming a complete efflux pump. These proteins were originally annotated as yhcQ (AaeA) and yhcP (AaeB) before their function was characterized . The AaeA component facilitates the connection between AaeB in the inner membrane and the outer membrane, creating a continuous channel for substrate export.

For structural determination, researchers should consider:

  • X-ray crystallography of purified protein

  • Cryo-electron microscopy for the complete AaeAB complex

  • Homology modeling based on E. coli structures

  • Circular dichroism spectroscopy to analyze secondary structure elements

What substrates are transported by the AaeA-containing efflux pump and how is this experimentally verified?

Based on studies of the E. coli AaeAB efflux system, the primary substrates are aromatic carboxylic acids. Specifically:

SubstrateTransport EfficiencyStructural Features
p-hydroxybenzoic acid (pHBA)HighAromatic ring with hydroxyl and carboxyl groups
6-hydroxy-2-naphthoic acidMediumBicyclic aromatic with hydroxyl and carboxyl groups
2-hydroxycinnamateMediumPhenylpropanoid structure

The efflux function of this pump was experimentally verified in E. coli through several approaches that could be applied to C. koseri :

  • Measuring hypersensitivity to pHBA in aaeA/aaeB mutant strains

  • Demonstrating that expression of aaeA and aaeB is necessary and sufficient to rescue this hypersensitivity

  • Conducting substrate specificity screening across hundreds of compounds to identify specific aromatic carboxylic acids as substrates

The physiological role of this efflux system appears to be as a "metabolic relief valve" to alleviate toxic effects of imbalanced metabolism .

How is the expression of aaeA regulated in Citrobacter species and what experimental approaches can verify these mechanisms?

Expression of aaeA in C. koseri is likely regulated similarly to E. coli, where it exists in an operon structure. The key regulatory elements include:

  • The aaeXAB operon structure - where aaeA and aaeB are co-transcribed with aaeX, a small protein of unknown function

  • Regulation by AaeR, a LysR-family transcriptional regulator encoded by the divergently transcribed aaeR gene

  • Induction by aromatic carboxylic acids, where several compounds serve as inducers for expression

The experimental verification of these mechanisms in C. koseri would require:

  • Reporter gene fusions (e.g., aaeA promoter-lacZ) to measure expression under different conditions

  • Real-time qPCR to quantify transcript levels in response to potential inducers

  • Electrophoretic mobility shift assays to demonstrate AaeR binding to the aaeA promoter region

  • RNA-seq analysis comparing wild-type and aaeR mutant strains to identify the complete regulon

  • DNase footprinting to identify the exact binding site of AaeR

What is the relationship between p-hydroxybenzoic acid metabolism and aaeA induction?

p-hydroxybenzoic acid (pHBA) serves as both a substrate for the AaeAB efflux pump and an inducer of its expression . This dual role creates a regulatory feedback loop:

  • pHBA is produced as an intermediate in aromatic compound metabolism

  • When pHBA reaches potentially toxic levels, it induces expression of the aaeXAB operon via AaeR

  • The resulting AaeAB efflux pump exports excess pHBA, maintaining cellular homeostasis

This system appears to function as a "metabolic relief valve" rather than a general xenobiotic resistance mechanism . In experimental settings, treatment of E. coli with pHBA resulted in significant upregulation of aaeA, aaeB, and aaeX gene expression.

Researchers investigating this relationship should:

  • Measure intracellular pHBA concentrations using LC-MS/MS

  • Monitor aaeA expression in response to varying pHBA concentrations

  • Assess the kinetics of pHBA export in wild-type versus aaeA mutant strains

  • Investigate potential metabolic perturbations that might lead to pHBA accumulation

What are the optimal conditions for expressing and purifying recombinant C. koseri AaeA protein?

Optimal expression and purification of recombinant C. koseri AaeA requires careful consideration of several factors:

Expression system optimization:

ParameterRecommended ConditionsRationale
Expression vectorpET with N-terminal His6 tagProvides high expression and tag for purification
Host strainC41(DE3) or C43(DE3)Specifically engineered for membrane protein expression
Induction conditions0.5 mM IPTG, 18°C, 16-20 hoursSlower expression improves proper folding
Growth mediaTB or 2xYT with 0.5% glucoseRich media supports membrane protein production

Purification strategy:

  • Cell lysis using French press or sonication in buffer containing:

    • 20 mM Tris-HCl pH 7.5

    • 300 mM NaCl

    • 5% glycerol

    • Protease inhibitor cocktail

  • Membrane extraction with detergents:

    • n-Dodecyl β-D-maltoside (DDM, 1%) for initial solubilization

    • Lower concentration (0.05%) for subsequent steps

  • Purification steps:

    • Immobilized metal affinity chromatography (IMAC)

    • Size exclusion chromatography for final polishing

    • Optional: Ion exchange chromatography if needed

  • Critical considerations:

    • Maintain detergent above critical micelle concentration throughout

    • Include glycerol (5-10%) to stabilize the protein

    • Consider co-expression with AaeB for functional studies

    • Validate proper folding using circular dichroism

What methods are most effective for measuring the transport activity of the AaeA-containing efflux pump?

Several complementary approaches can be used to assess AaeA-mediated transport activity:

1. Fluorescent substrate accumulation assays:

  • While ethidium bromide is commonly used for many efflux pumps, specific fluorescent aromatic carboxylic acid derivatives would be more suitable for AaeA

  • Real-time measurement of intracellular fluorescence by fluorometry or flow cytometry

  • Comparison between wild-type and aaeA knockout strains

2. Direct substrate transport measurements:

  • LC-MS/MS quantification of p-hydroxybenzoic acid in cellular and extracellular fractions

  • Time-course measurements to determine transport kinetics

  • Effect of metabolic inhibitors like carbonyl cyanide m-chlorophenylhydrazone (CCCP) to demonstrate energy dependence

3. Whole-cell efflux inhibition assays:

  • Assessment of p-hydroxybenzoic acid sensitivity with and without efflux inhibitors

  • Measurement of intracellular substrate accumulation in the presence of inhibitors

  • Determination of minimum inhibitory concentration shifts in the presence of potential inhibitors

4. Membrane vesicle transport assays:

  • Preparation of inside-out membrane vesicles containing the AaeAB complex

  • Measurement of substrate transport driven by proton gradient

  • Quantification of transport rates and kinetic parameters

When studying efflux pumps, it's important to note that the effect of proton gradient disruptors like CCCP can confirm the energy dependence of transport. In studies of the QepA efflux pump, for example, CCCP canceled the decreased intracellular accumulation of substrates, confirming the pump's energy-dependent nature .

What evidence exists for horizontal gene transfer of efflux pump genes between Citrobacter and other bacterial genera?

While the search results don't provide specific evidence for horizontal gene transfer (HGT) of aaeA genes, there is precedent for HGT of other efflux systems in Enterobacteriaceae:

  • The QepA fluoroquinolone efflux pump shows considerable similarity to transporters from environmental actinomycetes, suggesting intergeneric transfer from some environmental microbes to E. coli .

  • In C. koseri, yersiniabactin gene clusters located on the High Pathogenicity Island (HPI) appear to have been acquired horizontally, as they are more similar to those in Yersinia pestis than to genes in other Citrobacter species .

  • The transfer of ICE (Integrative and Conjugative Elements) containing yersiniabactin gene clusters has been observed between Citrobacter freundii strains and possibly across genera .

To investigate potential HGT of aaeA genes, researchers should:

  • Perform phylogenetic analysis of aaeA sequences across diverse bacteria

  • Look for incongruence between gene trees and species trees

  • Analyze GC content and codon usage bias in aaeA genes

  • Identify potential mobile genetic elements associated with the aae operon

  • Examine the genomic context of aaeA for signatures of integration events

How does the AaeA efflux pump contribute to antimicrobial resistance in Citrobacter species?

While the primary substrates of the AaeA-containing efflux pump are aromatic carboxylic acids rather than antibiotics, its potential contribution to antimicrobial resistance requires investigation:

  • Direct contribution:

    • The AaeAB pump may export certain antimicrobial compounds with aromatic carboxylic acid moieties

    • Upregulation of aaeA in response to metabolic stress might coincidentally reduce susceptibility to some drugs

  • Indirect contribution:

    • Cross-talk with other efflux systems might occur during stress responses

    • Metabolic adaptations involving aromatic compound processing might alter cellular physiology in ways that affect drug susceptibility

  • Regulatory overlap:

    • Regulators of aaeA expression might also influence expression of other resistance mechanisms

    • Exposure to certain antimicrobials might induce stress responses that activate aaeA expression

In experimental settings, researchers should:

  • Test antimicrobial susceptibility in aaeA knockout and overexpression strains

  • Investigate transcriptional responses to antimicrobial exposure

  • Analyze potential synergy between AaeA inhibition and antimicrobial treatment

  • Examine clinical isolates for correlations between aaeA expression and resistance phenotypes

How does the AaeA efflux pump differ from other types of bacterial efflux systems that contribute to antimicrobial resistance?

The AaeA-containing efflux system differs from other efflux pumps in several important aspects:

CharacteristicAaeAB SystemRND Pumps (e.g., AcrAB-TolC)Other MFS Transporters
Family classificationMFP (AaeA) + PET (AaeB)RND complex (3 components)Major Facilitator Superfamily
Primary substratesAromatic carboxylic acidsBroad range of antibioticsVariable (often specific)
Energy sourceProton motive forceProton motive forceProton motive force
Structural componentsTwo-component systemThree-component systemSingle component
RegulationAaeR (LysR family)Various (MarA, SoxS, etc.)Variable
Substrate specificityNarrow (specific compounds)Very broadOften specific

Unlike the clinically significant RND-type pumps like AcrAB-TolC that contribute substantially to multidrug resistance, the AaeAB system appears to have evolved primarily as a metabolic relief valve for aromatic carboxylic acids . The limited substrate range and specific regulatory mechanisms suggest it may not be a major player in clinical antimicrobial resistance.

What is the prevalence of AaeA efflux pump expression in clinical Citrobacter koseri isolates?

  • Develop a screening method:

    • RT-qPCR assays targeting aaeA transcripts

    • Phenotypic assays based on p-hydroxybenzoic acid susceptibility

    • Immunological detection of AaeA protein expression

  • Apply the screening to clinical collections:

    • Analyze diverse clinical isolates from various infection sites

    • Compare expression levels between isolates from different clinical sources

    • Correlate expression with patient demographics and treatment outcomes

  • Investigate inducing conditions in clinical settings:

    • Test whether clinical isolates show altered regulation of aaeA

    • Examine if hospital environments or treatments induce expression

    • Determine if host factors affect aaeA expression

Given the metabolic role of the AaeA efflux system, its expression might vary depending on the specific infection site and available nutrients, potentially influencing C. koseri adaptation to different host niches.

How does AaeA expression compare between antibiotic-resistant and antibiotic-susceptible Citrobacter koseri clinical isolates?

While the search results don't provide direct comparison data for AaeA expression between resistant and susceptible C. koseri isolates, this question highlights an important research direction:

  • Comparative analysis approach:

    • Collect paired resistant/susceptible C. koseri clinical isolates

    • Perform transcriptomic analysis (RNA-seq or microarray)

    • Quantify aaeA expression by RT-qPCR

    • Correlate expression with minimum inhibitory concentrations

  • Genetic manipulation studies:

    • Create isogenic strains with aaeA deletions or overexpression

    • Measure changes in antibiotic susceptibility profiles

    • Determine if AaeA contributes to acquired resistance phenotypes

  • Regulatory investigation:

    • Analyze the promoter regions of aaeA in resistant isolates

    • Identify potential mutations in regulatory elements

    • Test for cross-talk with known resistance regulators

How can CRISPR-Cas9 genome editing be optimized for functional studies of AaeA in Citrobacter koseri?

CRISPR-Cas9 genome editing offers powerful approaches for studying AaeA function in C. koseri:

Optimization protocol:

  • Delivery system selection:

    • Conjugative plasmids (e.g., pCas9-CR4)

    • Electroporation of ribonucleoprotein complexes

    • Phage-assisted delivery systems

  • Guide RNA design:

    • Target unique sequences within aaeA

    • Avoid off-target effects through careful bioinformatic analysis

    • Include NGG PAM sequences accessible in the C. koseri genome

    • Design multiple guides for each target to improve efficiency

  • Repair template optimization:

    • Homology arms of 500-1000 bp for efficient recombination

    • Include selection markers for screening

    • Consider scarless editing strategies with two-step selection

  • Verification strategies:

    • PCR screening of transformants

    • Sanger sequencing of edited regions

    • Whole genome sequencing to confirm lack of off-target effects

    • RT-qPCR to verify altered expression

  • Functional mutations to consider:

    • Complete gene deletion

    • Point mutations in functional domains

    • Promoter modifications to alter expression

    • Epitope tag insertions for protein localization studies

This approach would facilitate precise genetic manipulation of aaeA to determine its specific role in aromatic carboxylic acid efflux and potential contributions to other phenotypes in C. koseri.

What are the potential applications of engineered AaeA-based biosensors for environmental monitoring?

The substrate specificity of the AaeA-containing efflux system for aromatic carboxylic acids presents opportunities for biosensor development:

  • Sensing mechanism design:

    • Fusion of the aaeA promoter with reporter genes (GFP, luciferase)

    • Use of AaeR regulator as the sensing component

    • Engineering of constitutive expression systems with substrate-binding domains from AaeA/AaeB

  • Applications for environmental monitoring:

    • Detection of p-hydroxybenzoic acid in industrial waste streams

    • Monitoring of aromatic compound pollution in water systems

    • Screening for environmental samples containing specific aromatic carboxylic acids

  • Performance optimization:

    • Tuning dynamic range through promoter engineering

    • Improving sensitivity via protein engineering of AaeR

    • Enhancing specificity through directed evolution

  • Platform development:

    • Whole-cell biosensors in encapsulated formats

    • Cell-free systems using purified components

    • Portable field-deployable devices with immobilized sensing elements

Such biosensors would leverage the natural substrate specificity of the AaeA system while providing valuable tools for environmental monitoring of aromatic pollutants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.