Recombinant Citrobacter koseri Phosphoglycerol transferase I (mdoB)

Shipped with Ice Packs
In Stock

Description

Enzyme Function and Biological Role

Phosphoglycerol transferase I (EC 2.7.8.20), encoded by the mdoB gene, is integral to MDO biosynthesis. In C. koseri, MDOs are periplasmic glucans modified with phosphoglycerol and succinyl residues, contributing to osmoadaptation and membrane integrity . The enzyme transfers phosphoglycerol groups from phosphatidylglycerol to MDOs, producing sn-1,2-diglycerides as byproducts . Mutations in mdoB disrupt this process, leading to defective MDOs and growth inhibition under stress conditions .

Research Applications

  • Membrane Biosynthesis Studies: Used to elucidate MDO modification pathways and their role in bacterial stress responses .

  • Antibiotic Resistance: While C. koseri exhibits multi-drug resistance via β-lactamases and efflux pumps, mdoB is not a known resistance factor .

  • Vaccine Development: Subtractive proteomics identifies mdoB as non-antigenic in C. koseri, but related enzymes are explored for vaccine design .

Comparative Analysis with Other Species

Recombinant mdoB variants across Enterobacteriaceae show functional conservation but species-specific adaptations:

SpeciesHost SystemKey FeaturesReference
C. koseriE. coliChromosomal mdoB; no adjacent regulators
E. coliE. coliLinked to diglyceride kinase (dgk) pathway
Salmonella agonaCell-free expressionPlasmid-encoded mdoB; uncharacterized activity

Technical Challenges and Innovations

  • Expression Optimization: Low yields in E. coli due to toxicity of sn-1,2-diglyceride accumulation . Strains with dgk mutations (defective in diglyceride recycling) are avoided .

  • Structural Biology: Near-atomic models of homologous enzymes (e.g., PLD3/4) provide templates for mdoB catalytic mechanism studies .

Future Directions

  • Mechanistic Studies: Resolve crystal structures to map active-site residues and substrate specificity.

  • Biotechnological Engineering: Leverage mdoB in synthetic biology for glycan engineering or lipid modification .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mdoB; opgB; CKO_03440; Phosphoglycerol transferase I; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-763
Protein Length
full length protein
Species
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Target Names
mdoB
Target Protein Sequence
MSELLSIALFLASVLIYAWKAGRNTWWFAAILAVLGLFVVLNITLYASDYFTGDGINDAV LYTLTNSLTGAGVSKYILPGAGIVLALAAVFSALGWVLRRRRHHPHHFGYSLLALLLALG SVDASPAFRQISELVKSQSRDGDPDFPAYYKEPSKTIPNPQLNLVYIYGESLERTYFDND AFPDLTPELGALKNEGLDFSHTMQLPGTDYTIAGMVASQCGIPLFAPFEGNASASVSSFF PQNICLGDILKNSGYQNYFVQGANLRFAGKDVFLKSHGFDHLYGAEELKTVVADPSYRND WGFYDDTVLDEAWKKFEELSRSGQRFSLFTLTVDTHHPDGFISRTCNRKRYDFDGKPNQS FSAVSCSQENIAEFINKIKASPWFKNTVIVVSSDHLAMNNTAWKYLNKQDRNNLFFVLRG DQPQQDTLAVKRNTMDNGATVLDILGGDNFIGLGRSSLSGQSLSEVFLNSKEKILAMKPD IIRLWNFPKEMKDFTVDRDKDMIAFSGSHFRLPLLLRVSDKRVEPLPESEYSAPLRFQLA NFAPRDNFVWVDRCYKMAQLWAPELALSTDWCVSQGQLGGQQSIQHVDKAQWKGKTAFKD TVIDMERYKGNVDTLKIVDNDIRYKADSFIFNVAGAPEEVKQFSGISRPESWGRWSNAQL GDEVKIEYNTPLPKKFDLVITAKAFGANANRPIPVRVGKEEQTLVLENEVTTTTLHFDNP SNASTLVIVPPDPVSTNEGNILGHSPRKLGIGMVEIKVVNAEG
Uniprot No.

Target Background

Function
Transfers a phosphoglycerol residue from phosphatidylglycerol to the membrane-bound nascent glucan backbones.
Database Links
Protein Families
OpgB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Phosphoglycerol transferase I (mdoB) and what is its function in Citrobacter koseri?

Phosphoglycerol transferase I (mdoB) is a membrane-bound enzyme that plays a crucial role in bacterial cell envelope maintenance. In Citrobacter koseri, mdoB functions by transferring phosphoglycerol residues from phosphatidylglycerol to membrane-bound nascent glucan backbones . This catalytic activity can be represented by the reaction: Phosphatidylglycerol + membrane-derived-oligosaccharide D-glucose = 1,2-diacyl-sn-glycerol + membrane-derived-oligosaccharide 6-(glycerophospho)-D-glucose . The enzyme is primarily involved in glycan metabolism, specifically in the osmoregulated periplasmic glucan (OPG) biosynthesis pathway, which is essential for bacterial adaptation to changing osmotic conditions .

Where is mdoB localized in the bacterial cell and what protein family does it belong to?

Phosphoglycerol transferase I (mdoB) in Citrobacter koseri is localized in the cell inner membrane as a multi-pass membrane protein, spanning the membrane multiple times . This subcellular localization is consistent with its function in modifying membrane-associated oligosaccharides. Phylogenetically, mdoB belongs to the OpgB family of proteins, which are widely distributed among gram-negative bacteria and share conserved structural and functional features . The protein's membrane integration is critical for its ability to access both the phospholipid substrates in the membrane and the growing oligosaccharide chains.

What is the genomic context of the mdoB gene in Citrobacter koseri?

The mdoB gene in Citrobacter koseri is identified as CKO_03440 in genome annotations . Unlike some other bacterial genes, no specific transcriptional regulator has been identified upstream of the mdoB gene, suggesting it may be constitutively expressed or regulated as part of a larger operon structure. The genomic organization around mdoB plays a significant role in its expression patterns and response to environmental stimuli. The gene encodes a protein of 763 amino acids with a complex secondary structure necessary for its membrane integration and enzymatic function .

What expression systems are most effective for producing recombinant Citrobacter koseri mdoB protein?

For recombinant production of Citrobacter koseri mdoB, multiple expression systems have been successfully employed, including E. coli, yeast, baculovirus, and mammalian cell systems . The E. coli system, particularly using the pET-28a(+) vector, has shown promising results for high-yield expression of mdoB . When selecting an expression system, researchers should consider:

  • Protein folding requirements: As mdoB is a membrane protein, systems that facilitate proper membrane protein folding are preferable.

  • Post-translational modifications: If native glycosylation or other modifications are required for activity.

  • Scale of production: Laboratory research versus larger-scale applications.

  • Downstream applications: Structural studies may require higher purity than functional assays.

The expression system selection should be tailored to the specific research question and available resources. For structural studies, mammalian or insect cell systems may provide better native-like folding, while E. coli remains most cost-effective for initial characterization studies.

What purification strategies are most effective for isolating functional recombinant mdoB?

Purifying membrane proteins like mdoB presents unique challenges. A systematic approach involving the following steps has proven effective:

  • Membrane fraction isolation: After cell lysis, differential centrifugation separates membrane fractions containing mdoB.

  • Detergent solubilization: Careful selection of detergents is crucial. Mild detergents like n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) effectively solubilize mdoB while preserving its functional conformation.

  • Affinity chromatography: Using engineered tags (His-tag, commonly employed with the pET-28a(+) vector) facilitates initial capture .

  • Size exclusion chromatography: Secondary purification based on molecular size helps remove aggregates and contaminating proteins.

  • Activity-based verification: Enzymatic assays measuring phosphoglycerol transfer activity confirm the functional integrity of purified mdoB.

It is essential to maintain an appropriate detergent concentration throughout the purification process to prevent protein aggregation while avoiding excess detergent that might interfere with downstream applications.

How can the enzymatic activity of recombinant Citrobacter koseri mdoB be measured in vitro?

The enzymatic activity of recombinant mdoB can be assayed through several complementary approaches:

  • Direct activity assay: Measuring the transfer of phosphoglycerol from phosphatidylglycerol to acceptor oligosaccharides. This can be quantified by:

    • Radiolabeled substrate approach: Using 32P-labeled phosphatidylglycerol and measuring incorporation into oligosaccharide acceptors.

    • Mass spectrometry: Detecting mass shifts in oligosaccharide products after phosphoglycerol addition.

  • Coupled enzyme assays: Monitoring the production of 1,2-diacyl-sn-glycerol as a reaction by-product through coupling with diacylglycerol kinase and ATP consumption.

  • Structural verification: Characterizing the modified oligosaccharides using NMR spectroscopy or sophisticated mass spectrometry approaches to confirm the correct attachment position of phosphoglycerol moieties.

For accurate activity measurements, it is essential to establish optimal buffer conditions (pH 7.0-7.5), divalent cation requirements (typically Mg2+), and appropriate detergent concentrations that maintain protein stability without interfering with the assay.

How does mdoB contribute to Citrobacter koseri pathogenicity and antibiotic resistance?

Phosphoglycerol transferase I plays a significant role in C. koseri pathogenicity through multiple mechanisms:

  • Cell envelope integrity: By modifying periplasmic glucans, mdoB contributes to cell envelope stability, potentially protecting against host defense mechanisms and environmental stresses.

  • Biofilm formation: Modified periplasmic glucans influence bacterial surface properties, potentially enhancing adherence and biofilm formation, particularly relevant in urinary tract infections where C. koseri is commonly found .

  • Antibiotic penetration: Alterations in membrane permeability due to mdoB activity may affect the entry of certain antibiotics into the bacterial cell.

What structural features of mdoB are essential for its catalytic function?

Key structural elements of Citrobacter koseri mdoB critical for its function include:

  • Transmembrane domains: The protein contains multiple membrane-spanning regions essential for proper orientation in the cell inner membrane . These regions anchor the protein and position the catalytic domains appropriately relative to substrates.

  • Catalytic residues: Based on conserved features of the OpgB family, specific amino acid residues form the active site where phosphoglycerol transfer occurs.

  • Substrate binding pockets: Distinct regions for binding phosphatidylglycerol and oligosaccharide acceptors.

The amino acid sequence (provided in full in the product information ) reveals a complex protein with multiple functional domains. Computational analysis suggests that the N-terminal region contains most of the transmembrane segments, while central and C-terminal regions likely form the catalytic core.

Targeted mutagenesis studies of conserved residues would provide valuable insights into the precise structural requirements for catalytic activity and substrate specificity.

How can recombinant mdoB be utilized in vaccine development against Citrobacter koseri?

Recombinant mdoB presents a promising target for vaccine development against C. koseri infections, particularly for immunocompromised patients who are most susceptible to such infections . Current approaches include:

  • Epitope identification: Computational immunoinformatics and bioinformatics approaches similar to those used for other C. koseri proteins can identify potentially antigenic regions of mdoB . This would allow for:

    • B-cell epitope mapping for antibody-mediated responses

    • T-cell epitope identification for cell-mediated immunity

  • Subunit vaccine design: Rather than using the entire membrane-bound protein, specific antigenic fragments can be incorporated into multi-epitope vaccines, potentially combining with other C. koseri antigens for broader protection.

  • Adjuvant enhancement: Adding appropriate adjuvants (such as β-defensin) to mdoB-based vaccine candidates can significantly enhance immunological responses .

The membrane-associated nature of mdoB presents both challenges and opportunities - while expression and purification are technically demanding, its surface exposure makes it a potentially accessible target for antibody recognition in intact bacteria.

How conserved is mdoB across different Citrobacter species and other Enterobacteriaceae?

Phosphoglycerol transferase I (mdoB) shows significant conservation patterns across bacterial taxa, but with notable variations:

SpeciesIdentity to C. koseri mdoBKey Differences
C. freundii~75-80%Variations in membrane-spanning regions
C. braakii~72-77%Differences in substrate recognition domains
E. coli K-12~65-70%Conserved catalytic core, divergent regulatory regions
Salmonella spp.~60-65%Differences in oligosaccharide specificity
Klebsiella spp.~55-60%Variations in N-terminal signal sequence

This variability provides insights into species-specific adaptations while maintaining core enzymatic function. Unlike some other C. koseri enzymes, such as the chromosomal class A beta-lactamase CKO which shows only 41% identity with related Citrobacter species enzymes , mdoB appears to be more conserved, reflecting its fundamental role in cell envelope maintenance.

Phylogenetic analysis places C. koseri mdoB firmly within the OpgB family, with sequence analysis revealing evolutionarily conserved motifs essential for catalytic activity across all family members .

What functional differences exist between mdoB and related glycosyltransferases in bacterial systems?

Phosphoglycerol transferase I (mdoB) is part of a larger enzyme network involved in bacterial envelope biogenesis, with several distinguishing features:

  • Substrate specificity: While other glycosyltransferases often use nucleotide-activated sugars as donors, mdoB specifically utilizes phosphatidylglycerol as the phosphoglycerol donor .

  • Membrane association: Unlike many cytoplasmic glycosyltransferases, mdoB functions as an integral membrane protein, allowing direct access to membrane-derived substrates .

  • Osmoregulation connection: The mdoB-modified periplasmic glucans play specific roles in osmotic adaptation that distinguishes them from other bacterial glycoconjugates.

  • Coordination with other envelope enzymes: mdoB functions in concert with other enzymes involved in periplasmic glucan synthesis and modification, including initial glucan backbone synthesis and additional decorations.

These differences highlight mdoB's specialized role in bacterial physiology and potential as a specific target for antimicrobial development.

How do variations in mdoB sequences correlate with Citrobacter koseri virulence profiles?

Sequence variation analysis in mdoB genes across C. koseri clinical isolates reveals important connections to virulence:

  • Conservative mutations: Silent and missense mutations have been detected in mdoB genes from different C. koseri clinical isolates, though these particular variants displayed identical biochemical behaviors .

  • Virulence correlation: C. koseri isolates contain specialized iron uptake systems encoding yersiniabactin and aerobactin , which may function synergistically with mdoB-modified cell envelopes to enhance pathogenicity.

  • Strain variability: Different C. koseri strains show variations in both mdoB sequence and virulence-associated genes, potentially explaining differential clinical presentations, particularly in urinary tract infections and subsequent complications like perinephric abscesses .

What molecular dynamics simulation approaches are most appropriate for studying mdoB structure-function relationships?

Molecular dynamics (MD) simulations provide valuable insights into mdoB structure and function, with several specialized approaches being particularly relevant:

  • Membrane protein-specific simulations: As mdoB is a membrane protein, simulations must include appropriate lipid bilayer environments. Coarse-grained simulations using frameworks like MARTINI followed by fine-grained refinement can effectively model membrane integration.

  • Substrate binding analysis: Docking and MD simulations can reveal binding modes of phosphatidylglycerol and oligosaccharide substrates, similar to approaches used in analyzing vaccine interactions with immunological receptors .

  • Long-timescale dynamics: Enhanced sampling techniques (metadynamics, replica exchange) enable exploration of conformational changes associated with the catalytic cycle.

  • Water and ion dynamics: Explicit solvent simulations track water molecules and ions essential for catalysis, particularly important for enzymes like mdoB that function at the membrane-water interface.

Simulation parameters should include appropriate force fields optimized for membrane proteins (e.g., CHARMM36m, Amber Lipid17), physiological temperature (310K), and sufficient equilibration periods (>100ns) before production runs.

What are the optimal conditions for crystallization of recombinant mdoB for structural studies?

Membrane protein crystallization presents unique challenges, but several strategies have proven successful for proteins similar to mdoB:

  • Detergent screening: Systematic testing of detergents is crucial, with promising candidates including:

    • n-Dodecyl-β-D-maltoside (DDM)

    • Lauryl maltose neopentyl glycol (LMNG)

    • Octyl glucose neopentyl glycol (OGNG)

  • Lipidic cubic phase (LCP): This membrane-mimetic environment has revolutionized membrane protein crystallography and may be suitable for mdoB crystallization.

  • Protein engineering approaches:

    • Creating fusion constructs with crystallization chaperones like T4 lysozyme

    • Truncating flexible regions identified through limited proteolysis

    • Introducing surface mutations to enhance crystal contacts

  • Screening conditions: Initial broad screens followed by optimization of promising conditions, particularly focusing on:

    • pH range: 6.5-8.0

    • Precipitants: PEGs of various molecular weights

    • Additives: Small amphiphiles that stabilize detergent micelles

Alternative approaches like cryo-electron microscopy (cryo-EM) may circumvent crystallization challenges entirely and are increasingly viable for membrane proteins of mdoB's size (~85 kDa).

How can gene editing techniques be applied to study mdoB function in Citrobacter koseri?

Modern gene editing approaches offer powerful tools for investigating mdoB function in its native context:

These approaches, combined with phenotypic characterization (growth rates, antibiotic susceptibility, virulence in infection models), provide comprehensive insights into mdoB's role in C. koseri biology.

How might inhibitors of mdoB function be developed as potential antimicrobials against Citrobacter koseri?

The development of mdoB inhibitors represents a promising approach against C. koseri infections, particularly given the pathogen's increasing antibiotic resistance . Strategic approaches include:

  • Structure-based drug design: Using structural information to design compounds that:

    • Compete with phosphatidylglycerol at the donor binding site

    • Block oligosaccharide acceptor recognition

    • Disrupt protein conformational changes necessary for catalysis

  • High-throughput screening: Using biochemical assays to screen compound libraries for inhibitory activity against recombinant mdoB.

  • Fragment-based approaches: Building inhibitors by identifying small molecules that bind different regions of the protein and linking them to create high-affinity compounds.

  • Natural product exploration: Investigating natural compounds, particularly those from sources that compete with soil bacteria, for inhibitory activity.

The ideal inhibitor would combine:

  • High specificity for bacterial mdoB over mammalian glycosyltransferases

  • Ability to penetrate the bacterial outer membrane

  • Low propensity for resistance development

  • Favorable pharmacokinetic properties

Given the essential nature of cell envelope integrity, mdoB inhibitors could potentially overcome existing resistance mechanisms in C. koseri.

What biomarkers associated with mdoB activity could be useful for diagnosing and monitoring Citrobacter koseri infections?

Several potential biomarkers related to mdoB function and activity could improve C. koseri infection diagnostics:

  • Modified periplasmic glucans: Detection of phosphoglycerol-modified oligosaccharides in patient samples (urine, blood) could indicate active C. koseri infection. Mass spectrometry-based approaches could identify these specific molecular signatures.

  • Anti-mdoB antibodies: Patient serum antibodies targeting mdoB could indicate current or recent infection, potentially distinguishable from antibodies to mdoB homologs from other bacteria.

  • mdoB gene detection: PCR-based detection of the mdoB gene with primers specific to C. koseri could complement current diagnostic methods, similar to how bla(CKO)-specific PCR has been used to differentiate C. koseri from other Citrobacter species .

  • Expression patterns: Transcriptomics or proteomics approaches examining mdoB expression levels could indicate bacterial adaptation to host environments.

Integration of these biomarkers into clinical testing could improve differentiation between C. koseri and other Enterobacteriaceae that commonly cause urinary tract infections, potentially leading to more targeted therapeutic approaches .

What is the role of mdoB in Citrobacter koseri persistence in chronic infections?

In chronic infections, particularly those involving urinary tract complications , mdoB likely contributes to bacterial persistence through several mechanisms:

  • Biofilm contribution: The modified periplasmic glucans resulting from mdoB activity likely influence cell surface properties, potentially enhancing biofilm formation and maintenance, a key factor in chronic infections.

  • Stress protection: mdoB-dependent modifications help bacteria adapt to changing osmotic conditions, which is particularly relevant in environments like the urinary tract where osmolarity fluctuates significantly.

  • Immune evasion: Modified cell surface structures may alter recognition by host immune components, potentially helping C. koseri evade clearance mechanisms.

  • Antibiotic tolerance: While not directly conferring resistance like beta-lactamases , mdoB-mediated envelope modifications may contribute to a general stress tolerance that includes reduced susceptibility to certain antimicrobials.

The combined virulence factors of C. koseri, including iron acquisition systems and mdoB-related envelope modifications, create a particularly challenging pathogen in immunocompromised hosts. Understanding these persistence mechanisms is crucial for developing strategies to address chronic C. koseri infections, particularly in patients with urinary tract abnormalities or ileal conduits, who are at increased risk .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.