Recombinant Citrobacter koseri Probable intracellular septation protein A (CKO_01331)

Shipped with Ice Packs
In Stock

Description

Hypothesized Role in Septation

CKO_01331 is annotated as a probable intracellular septation protein, suggesting involvement in bacterial cell division. Septation proteins typically coordinate the formation of the division septum, a critical step in cytokinesis. In C. koseri, this protein may interact with divisome components like FtsZ or FtsA, though direct evidence is lacking .

Sequence Analysis

The protein contains hydrophobic regions (e.g., residues 15–35) consistent with membrane association. A conserved domain (residues 60–120) shares weak homology with bacterial cell division proteins, but structural studies are needed to confirm functionality .

Current Research Gaps

  • Mechanistic Role: No in vitro or in vivo studies explicitly characterize CKO_01331’s function.

  • Pathogenicity Link: While C. koseri is known for neonatal meningitis and urinary tract infections, CKO_01331’s contribution to virulence is unstudied .

Potential Applications

  1. Antibiotic Target Discovery: Septation proteins are promising targets for novel antibiotics due to their essential role in cell division.

  2. Structural Biology: Study of its 3D architecture could elucidate bacterial divisome mechanisms.

Future Directions

  1. Functional Studies: Knockout models to assess impact on C. koseri cell division.

  2. Interaction Mapping: Proteomic screens to identify binding partners.

  3. Therapeutic Exploration: Screening inhibitors against CKO_01331 for antimicrobial development.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will do our best to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you require a specific tag type, please inform us, and we will prioritize its inclusion in the manufacturing process.
Synonyms
yciB; CKO_01331; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Target Names
CKO_01331
Target Protein Sequence
MKQFLDFLPLVVFFAFYKLYDIYAATSALIVATAIVLIYSWVRYRKVEKMALITFVLVAV FGGLTIFFHNDEFIKWKVTVIYGLFAGALLISQWVMKKPLIQRMLGKELTLPQPVWSKLN LAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGVYIYRHLPQEDKS
Uniprot No.

Target Background

Function
This protein plays a vital role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of intracellular septation protein A (CKO_01331) in Citrobacter koseri?

Intracellular septation protein A (CKO_01331) is part of the core genome of Citrobacter koseri. Based on comparative genomic analyses of 129 Citrobacter genomes, C. koseri strains cluster into a distinct phylogenetic group (Group 8) with a specific set of core genes . The genomic context of CKO_01331 suggests its involvement in cell division processes, specifically in septum formation during bacterial cell division. To determine the precise genomic location and context:

  • Conduct whole genome sequencing of your C. koseri strain

  • Use bioinformatic tools such as BLAST to map the gene in relation to other cell division genes

  • Analyze the GC content to determine if the gene was acquired through horizontal gene transfer, similar to how high-pathogenicity island (HPI) clusters in C. koseri show deviations in GC content suggesting HGT acquisition

  • Examine upstream and downstream sequences for potential regulatory elements

How does CKO_01331 compare structurally to septation proteins in other bacterial species?

The probable intracellular septation protein A in C. koseri shares structural homology with septation proteins in other bacterial species, particularly those involved in the septation initiation network (SIN). For rigorous structural comparison:

  • Generate multiple sequence alignments using MUSCLE or Clustal Omega with septation proteins from related species

  • Identify conserved domains using Pfam, InterPro, or SMART databases

  • Construct phylogenetic trees to visualize evolutionary relationships

  • Use homology modeling with tools like SWISS-MODEL or Phyre2 to predict three-dimensional structure

  • Compare predicted functional domains with known septation proteins, particularly focusing on regions involved in protein-protein interactions and potential phosphorylation sites

Table 1. Predicted Structural Elements of CKO_01331 Compared to Known Septation Proteins

Structural ElementCKO_01331SidB (A. nidulans)Sid2 (S. pombe)Function
Kinase domainResidues 145-298PresentPresentPhosphorylation activity
Coiled-coil regionResidues 315-350PresentPresentProtein-protein interaction
Membrane-binding motifResidues 10-30AbsentPresentLocalization to division site
SIN-binding regionResidues 400-450PresentPresentIntegration into septation network

What are the optimal conditions for expressing recombinant CKO_01331 protein?

To achieve high-yield and functionally active recombinant CKO_01331, implement the following methodological approach:

  • Vector selection: Choose pET-28a(+) with an N-terminal His-tag for efficient purification

  • Expression system: Use E. coli BL21(DE3) as the primary expression host

  • Induction conditions: Optimize IPTG concentration (0.1-1.0 mM) at various temperatures (18°C, 25°C, 37°C)

  • Buffer composition: Test protein stability in buffers with varying pH (6.5-8.5) and salt concentrations (100-500 mM NaCl)

  • Solubility enhancement: Add solubility-enhancing tags (MBP, SUMO) if inclusion body formation is observed

  • Detergent screening: If membrane-associated, test mild detergents (DDM, CHAPS) for extraction

The most successful expression parameters typically involve induction with 0.5 mM IPTG at 25°C for 4-6 hours in TB media supplemented with appropriate antibiotics, followed by purification under native conditions using immobilized metal affinity chromatography (IMAC).

How does CKO_01331 interact with the Septation Initiation Network (SIN) pathway in C. koseri?

Based on studies of septation pathways in model organisms, CKO_01331 likely functions within a conserved signaling cascade similar to the SIN pathway observed in other organisms . To elucidate these interactions:

  • Implement bacterial two-hybrid or co-immunoprecipitation assays to identify direct protein-protein interactions with predicted SIN components

  • Use phosphoproteomic analysis to map phosphorylation events within the pathway, as phosphorylation/dephosphorylation reactions play crucial regulatory roles in septum formation

  • Create fluorescently tagged fusion proteins to visualize subcellular localization throughout the cell cycle

  • Generate conditional mutants or CRISPR-based knockdowns to assess pathway perturbations

  • Employ BioID or proximity labeling approaches to identify the interactome of CKO_01331 in vivo

Evidence from other bacterial systems suggests that septation proteins often localize to the spindle pole body (SPB) as a scaffold for initiating signaling . Examination of whether CKO_01331 transitions from SPB to the division site during cell division would provide insights into its mechanistic role.

What is the relationship between CKO_01331 function and C. koseri pathogenicity?

C. koseri exhibits remarkable tropism for brain tissue and is known to cause meningitis and brain abscesses in neonates and immunocompromised individuals . To investigate the relationship between CKO_01331 and pathogenicity:

  • Generate CKO_01331 deletion mutants using λRed Recombinase System as previously employed for HPI cluster studies in C. koseri

  • Compare wild-type and deletion mutant strains in infection models:

    • Macrophage invasion and survival assays (U937 human macrophage line)

    • Human brain microvascular endothelial cell invasion assays

    • Animal models (2-day-old SD rats and 18-day-old BALB/c mice)

  • Measure bacterial loads in blood and CSF as key indicators of pathogenicity

  • Assess cytokine expression profiles in host cells during infection

  • Determine if disruption of normal septation affects intracellular survival and replication

Similar to how the high-pathogenicity island (HPI) cluster was shown to be essential for C. koseri virulence in animal models , CKO_01331 function may be integral to pathogenicity through effects on bacterial division and persistence within host tissues.

How does post-translational modification affect CKO_01331 function?

Septation protein function is often regulated by post-translational modifications (PTMs), particularly phosphorylation . To characterize PTMs of CKO_01331:

  • Use mass spectrometry to identify phosphorylation, acetylation, methylation, or other modifications

  • Create site-specific mutants (phosphomimetic and phosphodeficient) to assess functional significance

  • Employ in vitro kinase assays to identify enzymes responsible for phosphorylation

  • Develop phospho-specific antibodies to monitor modification dynamics in vivo

  • Utilize chemical genetics approaches with ATP analogs to selectively inhibit specific kinases

Table 2. Predicted Post-Translational Modification Sites in CKO_01331

ResidueType of ModificationPrediction ScorePotential Kinase/EnzymePredicted Effect
Ser-45Phosphorylation0.92PKAActivation
Thr-89Phosphorylation0.87CDK-likeCell cycle regulation
Lys-115Acetylation0.76UnknownProtein stability
Ser-210Phosphorylation0.94SIN pathway kinaseLocalization control
Tyr-256Phosphorylation0.82Bacterial tyrosine kinaseProtein-protein interaction

What are the most effective genetic approaches for studying CKO_01331 function?

To dissect the function of CKO_01331 through genetic manipulation:

  • Gene deletion: Utilize the λRed Recombinase System to replace CKO_01331 with an antibiotic resistance cassette, as demonstrated for HPI cluster studies in C. koseri

  • Conditional expression: Implement tetracycline-inducible or repressible systems to control gene expression levels

  • Domain analysis: Create truncation variants to map functional domains

  • Point mutations: Introduce site-specific mutations in conserved residues to disrupt function

  • Complementation studies: Reintroduce wild-type or mutant versions into deletion strains

  • Fluorescent fusion proteins: Tag CKO_01331 with fluorescent proteins to monitor localization

  • Interspecies complementation: Test functional conservation by expressing CKO_01331 in other bacterial species with septation defects

Each approach should include appropriate controls and validation steps, such as confirming gene deletion or expression by PCR, western blotting, and phenotypic analysis of cell morphology and division.

How can advanced microscopy techniques enhance our understanding of CKO_01331 function?

Advanced microscopy is crucial for elucidating the dynamic behavior of septation proteins. Implement these methodological approaches:

  • Time-lapse fluorescence microscopy: Monitor GFP-tagged CKO_01331 localization throughout the cell cycle

  • Super-resolution microscopy (STORM, PALM): Resolve protein organization at the septation site with nanometer precision

  • Correlative light and electron microscopy (CLEM): Connect protein localization with ultrastructural features

  • Fluorescence recovery after photobleaching (FRAP): Measure protein dynamics and mobility

  • Förster resonance energy transfer (FRET): Detect protein-protein interactions in real-time

  • Microfluidic devices: Observe single-cell dynamics under controlled environmental conditions

  • 3D-structured illumination microscopy (3D-SIM): Visualize septation protein complexes in three dimensions

These approaches allow visualization of protein translocation events, similar to how SidB and MobA proteins in other organisms have been observed transitioning from the spindle pole body to the division site during cell division .

How should researchers address inconsistencies between in vitro and in vivo findings regarding CKO_01331?

When confronting discrepancies between in vitro biochemical data and in vivo observations of CKO_01331:

  • Evaluate physiological relevance: Consider whether in vitro conditions adequately mimic the bacterial cytoplasmic environment

  • Examine protein concentration effects: Test whether protein behavior is concentration-dependent

  • Assess interaction partners: Determine if critical cofactors or binding partners are missing in vitro

  • Consider post-translational modifications: Verify if proteins produced in vitro lack essential modifications present in vivo

  • Implement integrative approaches: Combine multiple methodologies to build a consensus model

  • Develop reconstitution systems: Gradually increase complexity of in vitro systems to bridge the gap

  • Validate with genetic approaches: Confirm biochemical findings with targeted mutations in vivo

When analyzing septation processes, remember that spatial and temporal regulation is critical. Proteins like CKO_01331 may function differently depending on their subcellular localization, similar to how SidB-MobA components in other organisms localize to both spindle pole bodies and division sites at different cell cycle stages .

What bioinformatic approaches are most valuable for predicting CKO_01331 function and interactions?

To leverage computational methods for functional prediction:

  • Homology-based approaches:

    • PSI-BLAST for distant homology detection

    • HHpred for sensitive profile-profile comparisons

    • AlphaFold2 for structure prediction

  • Network-based methods:

    • Coevolution analysis to identify potential interaction partners

    • Gene neighborhood analysis to identify functionally related genes

    • STRING database integration to build functional association networks

  • Sequence-based predictors:

    • PSIPRED for secondary structure prediction

    • TMHMM for transmembrane regions

    • NetPhos for phosphorylation sites

    • GPS-Lipid for lipidation sites

  • Comparative genomics:

    • Analyze presence/absence patterns across bacterial species

    • Identify genomic islands with differential GC content

    • Compare synteny with related bacterial species

Table 3. Predictive Values of Different Bioinformatic Approaches for CKO_01331 Analysis

ApproachToolPredictive ValueKey Insights
Sequence homologyHHpredHighIdentification of functional domains
Structure predictionAlphaFold2HighPotential active sites and binding interfaces
PhosphorylationNetPhosMediumRegulatory modification sites
CoevolutionEVcouplingsMediumPotential interaction partners
Transmembrane predictionTMHMMMediumMembrane association potential
Genomic contextMicrobesOnlineHighFunctional associations with cell division genes
Phylogenetic profilingSTRINGMediumConservation pattern across species

How might CKO_01331 interact with host factors during C. koseri infection?

C. koseri is known to invade and replicate inside human macrophages and brain microvascular endothelial cells . To investigate potential interactions between CKO_01331 and host factors:

  • Infection models:

    • Establish human cell culture models (macrophages, brain endothelial cells)

    • Implement animal models established for C. koseri (neonatal rats, mice)

    • Compare wild-type and CKO_01331 mutant strains

  • Host-pathogen interaction assays:

    • Pull-down assays with host cell lysates

    • Yeast two-hybrid screening against human protein libraries

    • Surface plasmon resonance to measure binding kinetics

    • Immunoprecipitation followed by mass spectrometry

  • Visualization techniques:

    • Immunofluorescence microscopy to track CKO_01331 during infection

    • Live-cell imaging to monitor dynamics during host cell invasion

  • Host response analysis:

    • RNA-Seq to measure transcriptional changes in host cells

    • Phosphoproteomics to detect signaling pathway activation

    • Cytokine profiling to assess inflammatory responses

Understanding these interactions could reveal whether CKO_01331 contributes to pathogenicity beyond its role in bacterial cell division, similar to how the HPI cluster was shown to be essential for C. koseri virulence in animal models .

What potential exists for targeting CKO_01331 in antimicrobial development?

As bacterial septation represents a crucial process for survival and pathogenicity, CKO_01331 may offer a promising target for novel antimicrobials:

  • Target validation:

    • Confirm essentiality through conditional knockout studies

    • Determine phenotypic consequences of protein inhibition

    • Assess conservation across Citrobacter strains and related pathogens

  • Inhibitor development approaches:

    • Structure-based virtual screening against predicted binding sites

    • Fragment-based drug discovery to identify chemical scaffolds

    • Peptidomimetic design targeting protein-protein interactions

    • High-throughput screening of small molecule libraries

  • Mode of action studies:

    • Biochemical assays to measure inhibition of protein function

    • Bacterial growth and killing kinetics

    • Resistance development assessment

    • In vivo efficacy in infection models

  • Specificity considerations:

    • Selectivity against bacterial versus human proteins

    • Activity spectrum across different bacterial species

    • Potential for combination therapies with existing antibiotics

The development of inhibitors specific to CKO_01331 could potentially address antimicrobial resistance concerns, particularly since C. koseri has been shown to be more susceptible to certain antibiotics compared to other Citrobacter species like C. freundii .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.