Recombinant Citrobacter koseri Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Citrobacter koseri Probable Ubiquinone Biosynthesis Protein UbiB (ubiB)

Recombinant Citrobacter koseri Probable ubiquinone biosynthesis protein UbiB (ubiB) is a recombinant protein derived from the bacterium Citrobacter koseri. This protein is involved in the biosynthesis of ubiquinone, a crucial component in the electron transport chain of bacteria. The UbiB protein plays a significant role in the synthesis pathway of ubiquinone, which is essential for bacterial energy production and survival.

Function and Importance of UbiB in Bacteria

The UbiB protein is part of the ubiquinone biosynthesis pathway, which involves several enzymes working together to produce ubiquinone. Ubiquinone is vital for the transfer of electrons during oxidative phosphorylation, allowing bacteria to generate ATP efficiently. In Citrobacter koseri, this protein is encoded by the ubiB gene and is crucial for maintaining the bacterium's energy metabolism.

Characteristics of Recombinant UbiB Protein

  • Source: The recombinant UbiB protein is derived from Citrobacter koseri, specifically from strains like ATCC BAA-895 / CDC 4225-83 / SGSC4696.

  • Sequence Information: The protein sequence is available, with a length of 546 amino acids, and its Uniprot accession number is A8ACY4.

  • Storage and Handling: The recombinant protein is typically stored in a Tris-based buffer with 50% glycerol at -20°C to maintain stability. Repeated freezing and thawing should be avoided.

  • Applications: This protein can be used in various biochemical assays, such as ELISA, to study ubiquinone biosynthesis or for research into Citrobacter koseri pathogenicity.

Data Table: Characteristics of Recombinant Citrobacter koseri UbiB Protein

CharacteristicDescription
SourceCitrobacter koseri (e.g., ATCC BAA-895)
Gene NameubiB
Protein Length546 amino acids
Uniprot AccessionA8ACY4
Storage Conditions-20°C in Tris-based buffer with 50% glycerol
ApplicationsBiochemical assays, ELISA

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ubiB; CKO_00178; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-546
Protein Length
full length protein
Species
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Target Names
ubiB
Target Protein Sequence
MTPGEVRRLYFIIRTFLSYGLDELIPKMRITLPLRLWRYSLFWMPNRHKDKPLGERLRLA LQELGPVWIKFGQMLSTRRDLFPPQIADQLALLQDKVAPFDGALAKAQIEEAMGGLPVEE WFDDFDIQPLASASIAQVHTARLKSNGKEVVIKVIRPDILPVIKADLKLIYRLARWVPRL LPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFENSPMLYVPEVYSDYCSQDM MVMERIYGIPVSDVATLEKNGTNMKLLAERGVQVFFTQVFRDSFFHADMHPGNIFVSYEH PENPKYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHVDSGWVPPDTNVEEFE FAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGVGRQLY PQLDLWKTAKPFLESWIKDQVGIPALTRALKEKAPFWVEKMPEIPELVYDSLRQGKYLQH SVDKIARELQENHVRQGQSRYLLGIGATLLLSGTFLLVSRPEWGLMPCWLMAGGLVAWLI GWRKTR
Uniprot No.

Target Background

Function
This protein is likely a protein kinase regulator of UbiI activity, which participates in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of UbiB in ubiquinone biosynthesis in Citrobacter koseri?

UbiB in C. koseri functions as an essential component in the oxygen-dependent pathway for ubiquinone (UQ) biosynthesis. The protein demonstrates ATPase activity and is specifically required for aerobic conditions of growth. When examining the metabolic pathway, UbiB participates in the hydroxylation reactions needed to modify the aromatic ring of 4-hydroxybenzoic acid (4-HB) during UQ synthesis .

Research methodologically demonstrates this role through knockout studies, where ΔubiB strains produce significantly reduced amounts of ubiquinone (UQ8) specifically under aerobic conditions . The experimental approach to confirm UbiB function typically involves:

  • Generation of targeted gene deletions using λ-Red recombination

  • Complementation studies with plasmid-expressed ubiB

  • HPLC quantification of ubiquinone levels under varying oxygen conditions

  • Assessment of growth rates in defined media with differential carbon sources

How is recombinant C. koseri UbiB typically expressed and purified for functional studies?

For optimal expression and purification of recombinant C. koseri UbiB, researchers should employ the following methodological approach:

  • Cloning the ubiB gene with appropriate tags (typically N-terminal His6 or Strep-tag)

  • Expression in E. coli BL21(DE3) or similar strain using an inducible system (IPTG-inducible T7 promoter)

  • Growth at lower temperatures (16-20°C) after induction to enhance protein solubility

  • Cell lysis under anaerobic conditions to maintain native protein structure

  • Purification using affinity chromatography followed by size exclusion

Critical consideration must be given to buffer composition, as the ATPase activity of UbiB requires specific conditions:

  • pH maintained at 7.5-8.0

  • Inclusion of magnesium (1-5 mM MgCl₂)

  • Addition of reducing agents (1-5 mM DTT or TCEP)

  • Potential addition of ubiquinone precursors for stability

The purified protein can then be assessed for ATPase activity using malachite green phosphate detection assays or radioactive ATP hydrolysis assays.

What experimental systems are best suited for studying C. koseri UbiB function?

To effectively study C. koseri UbiB function, researchers should consider complementary experimental systems:

In vivo systems:

  • C. koseri ubiB knockout strains complemented with wild-type or mutant ubiB variants

  • E. coli ubiB mutants complemented with C. koseri ubiB for comparative studies

  • Growth under varying oxygen concentrations (aerobic, microaerobic, anaerobic)

  • Infection models in appropriate animals (neonatal rat and mouse models)

In vitro systems:

  • Reconstituted ubiquinone biosynthesis assays with purified components

  • ATPase activity measurements with varying substrates

  • Protein-protein interaction studies with other ubiquinone biosynthesis components

  • Membrane association assays to determine subcellular localization

Analytical approaches:

  • LC-MS/MS for identification of reaction intermediates

  • HPLC for quantification of ubiquinone and precursors

  • RNA-seq for transcriptional analysis under varying conditions

  • Protein co-immunoprecipitation to identify interaction partners

The combination of these systems provides comprehensive insights into UbiB function and regulation within the broader context of ubiquinone biosynthesis.

How does the function of UbiB differ between the aerobic and anaerobic ubiquinone biosynthesis pathways in C. koseri?

The function of UbiB shows striking pathway-specific activity in C. koseri ubiquinone biosynthesis. UbiB operates exclusively in the oxygen-dependent pathway, as demonstrated by the observation that ΔubiB strains produce limited ubiquinone only under aerobic conditions . In contrast, under anaerobic conditions, C. koseri employs an alternative O₂-independent pathway for ubiquinone biosynthesis that does not require UbiB.

Methodologically, this differential function can be investigated through:

  • Metabolomic profiling of ubiquinone intermediates in wild-type vs. ΔubiB strains under varying O₂ conditions

  • Isotope labeling studies using ¹³C-labeled precursors to track carbon flow through different pathways

  • Comparative transcriptomics and proteomics of cells grown under aerobic vs. anaerobic conditions

  • In vitro reconstitution of both pathways with purified components

Research findings indicate that while the O₂-dependent pathway utilizes UbiB for hydroxylation reactions, the O₂-independent pathway employs alternative hydroxylases (UbiU-UbiV) that utilize [4Fe-4S] clusters to catalyze similar reactions without molecular oxygen . This represents a remarkable example of metabolic plasticity that allows proteobacteria like C. koseri to synthesize ubiquinone across the entire range of environmental oxygen levels.

Pathway ComponentO₂-dependent (Aerobic)O₂-independent (Anaerobic)
Initial enzymes (UbiA)RequiredRequired
UbiBRequiredNot required
UbiJ/UbiKRequiredNot required
UbiU/UbiVNot requiredRequired
Terminal enzymes (UbiE, UbiG)RequiredRequired
Oxygen requirementMolecular O₂ as substrateNo O₂ required
Iron-sulfur clustersNot used[4Fe-4S] in UbiU/UbiV

What structural and functional domains in C. koseri UbiB are critical for its role in ubiquinone biosynthesis?

C. koseri UbiB contains several crucial domains that define its function in ubiquinone biosynthesis:

  • N-terminal nucleotide-binding domain: Contains the Walker A and Walker B motifs essential for ATP binding and hydrolysis

  • C-terminal α-helical domain: Likely involved in protein-protein interactions with other ubiquinone biosynthesis enzymes

  • Conserved LYK motif: Critical for catalytic activity, potentially involved in substrate recognition

  • Membrane-association motifs: Hydrophobic patches that facilitate association with the inner membrane where ubiquinone synthesis occurs

Methodological approaches to investigate domain functionality include:

  • Site-directed mutagenesis of key residues followed by complementation assays

  • Truncation analysis to define minimal functional domains

  • Domain-swapping experiments with homologous proteins from other species

  • Hydrogen-deuterium exchange mass spectrometry to identify substrate-binding regions

  • Crystallography or cryo-EM structural studies combined with molecular dynamics simulations

Functional analysis should employ activity assays measuring:

  • ATP hydrolysis rates with purified protein

  • Binding affinity for ubiquinone precursors

  • Protein-protein interaction strength with other pathway components

  • In vivo complementation efficiency of mutant variants

Research indicates that mutations in the Walker A motif (particularly the lysine residue) abolish ATPase activity and consequently ubiquinone biosynthesis, suggesting that ATP hydrolysis is coupled to the catalytic function of UbiB in the hydroxylation reactions of the ubiquinone pathway.

How does the expression of recombinant C. koseri UbiB impact bacterial virulence and pathogenicity?

The relationship between UbiB expression and C. koseri virulence presents an intriguing area of research. While not directly identified as a classical virulence factor, UbiB's role in ubiquinone biosynthesis indirectly affects bacterial pathogenicity through modulation of energy metabolism and stress responses.

Methodological approaches to investigate this relationship include:

  • Infection models with UbiB variants:

    • Neonatal rat and mouse models of meningitis and brain abscess formation

    • Comparison of wild-type, ΔubiB, and complemented strains

    • Measurement of bacterial loads in blood and cerebrospinal fluid

    • Histopathological examination of infected tissues

  • Virulence assays:

    • Survival within macrophages and brain microvascular endothelial cells

    • Biofilm formation capability

    • Resistance to oxidative and nitrosative stress

    • Growth in iron-limited conditions

  • Transcriptional analysis:

    • RNA-seq comparing expression profiles of wild-type and ΔubiB strains during infection

    • ChIP-seq to identify regulators of ubiB expression under different conditions

    • qRT-PCR validation of key virulence genes

Research findings suggest that UbiB-dependent ubiquinone biosynthesis may be particularly important during certain phases of infection. Since C. koseri can cause meningitis and brain abscess in neonates and immunocompromised individuals , the ability to synthesize ubiquinone under varying oxygen tensions within host tissues is likely critical for sustained virulence. The brain environment, in particular, may present unique oxygen gradients that require metabolic flexibility.

The impact of UbiB on virulence should be considered alongside other identified C. koseri virulence factors, including those involved in flagellar apparatus biosynthesis (ompA, csg fimbriae, and the che operon) and iron uptake systems (chu, fep, and ent) .

What is the relationship between UbiB and the high-pathogenicity island (HPI) cluster in C. koseri?

While direct evidence for interaction between UbiB and the high-pathogenicity island (HPI) in C. koseri is limited, integrative analysis suggests potential functional relationships worthy of investigation.

The HPI cluster in C. koseri has been identified as a key virulence determinant, with deletion mutants showing significantly decreased virulence in animal models . This cluster is involved in iron acquisition, which is essential for bacterial pathogenesis. Ubiquinone biosynthesis and iron metabolism are interconnected through several mechanisms:

  • Respiratory chain function: Ubiquinone-dependent respiration requires iron-containing proteins

  • Oxidative stress resistance: Both systems contribute to managing oxidative stress

  • Energy provision for iron transport: ATP generated via ubiquinone-dependent respiration powers iron acquisition systems

Methodological approaches to investigate this relationship include:

  • Construction of double mutants (ΔubiB/ΔHPI) to assess synergistic effects

  • Transcriptional analysis of iron uptake genes in ΔubiB strains

  • Measurement of intracellular iron levels in various mutant backgrounds

  • Assessment of ubiquinone levels in HPI mutants

Animal studies have demonstrated that HPI deletion severely attenuates C. koseri virulence in vivo, with mutants losing the ability to replicate in the brain . Similar studies with UbiB mutants could reveal whether ubiquinone biosynthesis defects result in comparable attenuation, potentially suggesting a functional link between these systems.

ParameterWild-type C. koseriΔHPI MutantPotential ΔubiB Phenotype
Brain ColonizationHighSeverely reducedLikely reduced under aerobic conditions
Blood SurvivalHighModerately reducedLikely strain context-dependent
Survival Time in Animal Models36h (rats), 144h (mice)84h (rats), survived (mice)Predicted intermediate phenotype
Iron AcquisitionEfficientCompromisedIndirectly affected
Respiratory CapacityFullPotentially compromisedReduced under aerobic conditions

How do oxygen-sensing mechanisms regulate UbiB expression and function in C. koseri during environmental transitions?

The regulation of UbiB in response to environmental oxygen levels represents a sophisticated example of bacterial adaptation. Given that UbiB functions specifically in the O₂-dependent pathway for ubiquinone biosynthesis, its expression and activity must be precisely coordinated with oxygen availability.

Methodological approaches to investigate oxygen-dependent regulation include:

  • Transcriptional analysis:

    • Promoter mapping using 5' RACE

    • Reporter fusion assays (lacZ, gfp) to monitor promoter activity

    • ChIP-seq to identify transcription factors binding the ubiB promoter

    • RNA-seq comparing expression under aerobic, microaerobic, and anaerobic conditions

  • Protein-level regulation:

    • Western blotting to quantify UbiB levels under different oxygen tensions

    • Pulse-chase experiments to determine protein stability

    • Post-translational modification analysis using mass spectrometry

    • Protein-protein interaction screens to identify regulatory partners

  • Functional assays:

    • Measurement of ATPase activity under different redox conditions

    • Assessment of membrane association as a function of oxygen availability

    • Determination of ubiquinone synthesis rates during oxygen transitions

Research findings suggest that bacteria equipped with both O₂-dependent and O₂-independent pathways, like C. koseri, have evolved sophisticated regulatory mechanisms to seamlessly transition between these pathways . This metabolic plasticity likely involves multiple layers of regulation, from transcriptional control to allosteric modulation of enzyme activity.

Potential oxygen-sensing mechanisms regulating UbiB may include:

  • FNR-like transcription factors that respond directly to oxygen

  • ArcAB two-component system sensing respiratory chain status

  • SoxRS system responding to oxidative stress

  • Iron-sulfur cluster-containing regulators sensitive to oxygen and iron availability

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.