Recombinant Citrobacter koseri Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Molecular Function and Biological Role

Recombinant Citrobacter koseri prolipoprotein diacylglyceryl transferase (Lgt) is an engineered form of the enzyme responsible for the first step in bacterial lipoprotein biosynthesis. Lgt catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the thiol group of a conserved cysteine residue in prolipoproteins, forming a thioether bond . This modification is critical for anchoring lipoproteins to the bacterial membrane, enabling their roles in nutrient uptake, antibiotic resistance, and virulence .

While structural and functional studies of Lgt are well-documented in Escherichia coli , research on C. koseri Lgt remains limited. Genomic analyses confirm that C. koseri retains the lgt gene as part of its conserved lipoprotein biosynthesis pathway, which is essential for membrane integrity and pathogenicity .

Recombinant Production and Applications

Recombinant C. koseri Lgt is synthesized by cloning the lgt gene into expression vectors (e.g., E. coli pET-28a(+)) for large-scale production . Applications include:

  1. Antibacterial Drug Development: Lgt is a validated target for novel antibiotics. Inhibitors blocking its activity disrupt lipoprotein anchoring, compromising bacterial survival .

  2. Mechanistic Studies: Used to analyze substrate specificity and enzyme kinetics (e.g., glycerol phosphate release assays) .

  3. Vaccine Design: Lipoproteins are immunogenic; recombinant Lgt aids epitope mapping for multi-antigen vaccines .

Challenges and Research Gaps

  1. Limited Direct Studies: Most data are extrapolated from E. coli Lgt . C. koseri-specific structural studies are needed.

  2. Resistance Mechanisms: C. koseri exhibits multidrug resistance via β-lactamases and efflux pumps , but Lgt’s role in resistance remains uncharacterized.

  3. Inhibitor Cross-Reactivity: Current Lgt inhibitors (e.g., G9066, IC₅₀ = 0.24 μM) target E. coli; efficacy against C. koseri is untested .

Future Directions

  1. Structural Biology: Cryo-EM or X-ray crystallography to resolve C. koseri Lgt’s 3D architecture.

  2. High-Throughput Screening: Identify species-specific Lgt inhibitors using recombinant enzyme assays.

  3. Pathogenicity Studies: Link Lgt activity to C. koseri virulence in meningitis and urinary tract infections .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your needs in the order notes. We will prepare your order according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: Our standard shipping includes blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference point for your preparations.
Shelf Life
The shelf life of our product is influenced by factors such as storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form exhibits a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is established during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; CKO_04195; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Target Names
lgt
Target Protein Sequence
MTSSYLHFPEFDPVIFSIGPVALHWYGMMYLVGFVFAMWLAIRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPLFLENPLYLFRVWDGGMSFHGGLIGVILVMVIFARRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPSFPFAMLFPGSRAEDIELLPSN PQWQSIFDTYGVLPRHPSQLYELVLEGIVLFIILNLFIRKSRPMGAVSGLFLIGYGAFRI IVEFFRQPDAQFTGAWVQYISMGQILSIPMIVAGVIMMVWAYRRSPQQHVS
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) is an enzyme that catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This process is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biochemical mechanism of Lgt in bacterial lipoprotein biosynthesis?

Lgt catalyzes the first critical step in the biogenesis of bacterial lipoproteins by transferring a diacylglyceryl moiety from phosphatidylglycerol to the thiol group of the conserved cysteine residue at the +1 position in the lipobox motif via a thioether bond . All bacterial preprolipoproteins containing a signal peptide followed by a conserved four amino acid sequence, [LVI][ASTVI][GAS]C (known as the lipobox), are secreted through the inner membrane via the Sec or Tat pathways before modification by Lgt . The reaction catalyzed by Lgt releases glycerol phosphate as a byproduct, which can be either glycerol-1-phosphate (G1P) or glycerol-3-phosphate (G3P) depending on the racemic glycerol moiety in the phosphatidylglycerol substrate . This diacylglyceryl modification is essential for proper anchoring of lipoproteins to bacterial membranes and serves as a prerequisite for subsequent processing steps by LspA and Lnt enzymes.

How does inhibition of Lgt affect bacterial cell physiology?

Inhibition of Lgt in Gram-negative bacteria produces multiple deleterious effects on cell physiology that collectively compromise bacterial viability. Lgt depletion in clinical uropathogenic Escherichia coli leads to permeabilization of the outer membrane, rendering bacteria more susceptible to serum killing and antibiotics . At the molecular level, Lgt inhibition causes accumulation of unmodified prolipoprotein (UPLP) forms that alter membrane architecture and function . Microscopic analysis reveals that Lgt inhibitors induce characteristic outer membrane blebbing and significant increases in cell size, similar to phenotypes observed in Pal-deficient E. coli strains . Unlike inhibition of other lipoprotein biogenesis enzymes, Lgt inhibition cannot be rescued by deletion of the major outer membrane lipoprotein lpp, suggesting a unique mechanism of action that may circumvent common resistance mechanisms . These physiological effects demonstrate that Lgt function is critical for maintaining bacterial envelope integrity and homeostasis.

What structural features are critical for Lgt enzymatic activity?

While specific structural information for Citrobacter koseri Lgt is limited, comparative analysis with other Gram-negative bacterial Lgt proteins reveals several conserved structural elements essential for catalytic activity. The enzyme contains membrane-embedded regions that facilitate access to phosphatidylglycerol substrates within the inner membrane . Current understanding suggests that Lgt likely possesses a highly conserved phosphatidylglycerol binding site that is essential for substrate recognition and catalysis . Mutations disrupting this binding site potentially result in loss of Lgt function leading to cell death, which explains the difficulty in generating on-target resistant mutants to Lgt inhibitors . The active site architecture appears to be evolutionarily constrained across Gram-negative species, as inhibitors developed against E. coli Lgt also demonstrate activity against other bacteria like Acinetobacter baumannii . Recent publications have provided significant insights into the potential mechanisms of diacylglyceryl modification by Lgt, though further structural studies are needed to fully elucidate the catalytic mechanism across different bacterial species .

What expression systems yield highest activity for recombinant Citrobacter koseri Lgt?

For optimal expression of active recombinant Citrobacter koseri Lgt, E. coli-based expression systems with careful consideration of membrane protein challenges are most effective. Based on successful approaches with homologous proteins, the recommended methodology involves using E. coli strains specifically engineered for membrane protein expression, such as C41(DE3) or C43(DE3) . Expression vectors containing mild inducible promoters (such as trc or rhamnose-inducible systems) rather than strong T7 promoters help prevent aggregation and toxicity issues. Induction should be performed at lower temperatures (16-20°C) with reduced inducer concentrations to allow proper membrane insertion and folding. Addition of specific detergents (0.02% n-dodecyl β-D-maltoside as used for E. coli Lgt) to the growth media can enhance membrane protein solubility . For functional studies, construction of a C-terminal fusion with affinity tags (His6 or biotin) separated by flexible linkers preserves enzymatic activity while enabling purification, as demonstrated in the successful affinity selection of macrocyclic peptides binding to E. coli Lgt-biotin .

What are the critical considerations for purifying active Lgt enzyme?

Purification of active Citrobacter koseri Lgt requires careful attention to membrane protein solubilization and stability factors throughout the isolation process. The initial critical step involves membrane fraction isolation through differential centrifugation, followed by selective solubilization using mild detergents like n-dodecyl β-D-maltoside (DDM) at 0.02% concentration, which effectively maintains Lgt in an active conformation as demonstrated with E. coli Lgt . During affinity chromatography, buffer composition should include 50 mM Tris (pH 8), 5 mM EDTA, 200 mM NaCl, 0.02% DDM, and 1 mM glutathione to maintain protein stability and activity . Purification should be performed at 4°C to minimize protein degradation, with elution fractions immediately supplemented with phospholipids to stabilize the enzyme. Size-exclusion chromatography as a final polishing step helps remove aggregates and ensures homogeneous protein preparation. Activity assays should be performed immediately after purification to confirm enzyme functionality, measuring the release of glycerol phosphate from phosphatidylglycerol substrate as described for E. coli Lgt .

How can researchers stabilize purified Lgt for in vitro studies?

Maintaining stability of purified Citrobacter koseri Lgt for extended periods requires multiple strategic approaches targeting the unique challenges of membrane protein enzymes. Researchers should incorporate phosphatidylglycerol or other native lipids at 0.01-0.05% concentration in all storage buffers to mimic the native membrane environment and preserve the active site conformation . Storage buffer optimization should include glycerol (20-25%) to prevent freeze-thaw damage, reducing agents (1-5 mM DTT or β-mercaptoethanol) to prevent oxidation of critical cysteine residues, and protease inhibitor cocktails to minimize degradation. Aliquoting into single-use volumes and flash-freezing in liquid nitrogen with storage at -80°C helps maintain activity for months. For functional studies requiring extended incubation times, detergent micelles can be exchanged for more stable nanodiscs or lipid bilayer mimetics through gradual dialysis. Stability can be monitored through periodic activity assays measuring the release of glycerol phosphate using the coupled luciferase reaction approach described for E. coli Lgt .

What biochemical assays accurately measure Lgt activity in vitro?

Several biochemical assays can be employed to accurately measure Citrobacter koseri Lgt activity in vitro, with the glycerol phosphate detection assay being particularly robust. The primary approach measures the release of glycerol phosphate, a byproduct of the Lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to peptide substrates . When using racemic phosphatidylglycerol substrates, both glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) are released . Detection can be accomplished through a coupled luciferase reaction system that offers high sensitivity and reproducibility . The assay requires purified Lgt (0.1-1 μM), phosphatidylglycerol substrate (10-100 μM), and peptide substrates derived from native lipoproteins containing the lipobox motif (such as Pal-IAAC where C is the conserved cysteine modified by Lgt) . Reaction progress can be monitored continuously by luminescence detection or at discrete timepoints. Negative controls should include mutant peptide substrates with cysteine to alanine substitutions (e.g., Pal-IAAA), which cannot undergo diacylglyceryl transfer .

How can researchers evaluate Lgt substrate specificity?

Evaluating substrate specificity of Citrobacter koseri Lgt requires systematic analysis of both phospholipid and peptide substrate variations using quantitative biochemical approaches. For peptide substrate specificity assessment, researchers should synthesize a panel of peptides with systematic variations in the lipobox motif ([LVI][ASTVI][GAS]C) and flanking residues derived from predicted Citrobacter koseri lipoproteins . The reaction efficiency with each peptide variant can be measured using the glycerol phosphate detection assay described previously . For phospholipid substrate analysis, researchers should compare Lgt activity with various phospholipids including phosphatidylglycerol variants with different fatty acid chain lengths and saturation levels, phosphatidylethanolamine, and phosphatidylcholine. Kinetic parameters (Km and kcat) should be determined for each substrate combination to establish preference profiles. Competition assays, where unlabeled substrates compete with labeled substrates, provide additional insights into binding affinity. Furthermore, site-directed mutagenesis of conserved Lgt residues followed by activity analysis with various substrates can help identify amino acids specifically involved in recognition of different substrate features .

What cellular assays confirm Lgt inhibition in bacterial systems?

Several complementary cellular assays can reliably confirm Lgt inhibition in bacterial systems, providing mechanistic validation of potential inhibitors. Western blot analysis of lipoprotein processing intermediates represents the most definitive approach, specifically detecting accumulation of unmodified prolipoprotein (UPLP) forms upon Lgt inhibition . This technique employs SDS-PAGE separation of bacterial cell lysates followed by immunoblotting with antibodies against abundant lipoproteins like Lpp . Additionally, researchers should implement SDS fractionation protocols to separate peptidoglycan-associated proteins (PAP) from non-PAP fractions, allowing identification of various Lpp forms with distinct migration patterns . Complementary assays include microscopic evaluation of outer membrane integrity, looking for characteristic blebbing and increased cell size that occur upon Lgt inhibition . CRISPRi-based genetic sensitization provides another powerful validation approach, where decreased expression of lgt specifically sensitizes cells to Lgt inhibitors but not inhibitors of other lipoprotein processing enzymes . Finally, monitoring bacterial sensitivity to serum killing and antibiotics provides functional confirmation of outer membrane permeabilization resulting from Lgt inhibition .

What high-throughput screening approaches identify effective Lgt inhibitors?

Effective high-throughput screening for Citrobacter koseri Lgt inhibitors employs a multi-tiered strategy combining biochemical, binding, and cellular assays. Initial screening should utilize the glycerol phosphate detection assay in a miniaturized format, measuring inhibition of Lgt enzymatic activity with fluorescence or luminescence readouts . Compounds showing >50% inhibition at 10 μM concentration should advance to dose-response determination for IC50 calculation, with potent inhibitors typically showing submicromolar values (G9066: IC50=0.24 μM, G2823: IC50=0.93 μM, G2824: IC50=0.18 μM) . Target engagement can be confirmed through biophysical binding assays such as the affinity selection approach used successfully with macrocyclic peptides against E. coli Lgt-biotin in 0.02% n-dodecyl β-D-maltoside . This method utilizes streptavidin-coated beads to isolate compounds binding to biotinylated Lgt . Cellular confirmation should employ CRISPRi technology to decrease gene expression of lgt, creating sensitized bacterial strains that show enhanced susceptibility to on-target inhibitors compared to control compounds like LspAi and LolCDEi . Finally, phenotypic validation should include Western blot detection of unmodified prolipoprotein accumulation, which specifically occurs with Lgt inhibition .

How do researchers distinguish between Lgt inhibition and other lipoprotein processing enzyme inhibition?

Distinguishing Lgt inhibitors from inhibitors of other lipoprotein processing enzymes requires molecular and phenotypic profiling focused on pathway-specific intermediates and genetic interaction patterns. Western blot analysis of lipoprotein processing provides the most definitive differentiation method, as each enzyme inhibition produces unique accumulation patterns: Lgt inhibition specifically leads to accumulation of unmodified prolipoprotein (UPLP) , while LspA inhibition causes accumulation of diacylglyceryl-modified prolipoprotein (DGPLP) and other peptidoglycan-linked Lpp forms . CRISPRi-based genetic sensitization offers another powerful differentiation tool, as decreased expression of specific pathway enzymes selectively sensitizes cells to their respective inhibitors – lgt downregulation specifically enhances sensitivity to Lgt inhibitors but not LspAi or LolCDEi compounds . Perhaps most significantly, genetic deletion studies reveal fundamentally different resistance profiles – deletion of lpp rescues growth after LspA inhibition but provides no protection against Lgt inhibitors, representing a critical distinguishing feature . Additionally, while all three enzyme inhibitions disrupt outer membrane integrity, only Lgt inhibition leads to OM blebbing with decreased PG-linkage without significant accumulation of toxic DGPLP or other PG-linked Lpp forms .

What molecular scaffolds show promise as Lgt inhibitors?

Current research indicates several promising molecular scaffolds for development of potent and selective Citrobacter koseri Lgt inhibitors. Macrocyclic peptides have demonstrated particular promise as Lgt inhibitors, with compounds like G9066, G2823, and G2824 showing potent biochemical inhibition of E. coli Lgt activity with IC50 values in the submicromolar range (0.24 μM, 0.93 μM, and 0.18 μM, respectively) . These macrocycles were identified through affinity selection strategies targeting purified Lgt protein and subsequently validated through multiple biochemical and cellular approaches . Structure-activity relationship studies suggest these compounds may interact with the highly conserved phosphatidylglycerol binding site of Lgt, though the precise binding mode requires further elucidation . Unlike globomycin and myxovirescin which target LspA, these macrocyclic Lgt inhibitors demonstrate bactericidal activity against wild-type bacterial strains that cannot be overcome by common resistance mechanisms like lpp deletion . The apparent conservation of the Lgt active site across Gram-negative species suggests that inhibitors developed against E. coli Lgt may show broad-spectrum activity against related pathogens including Citrobacter koseri .

How can inducible deletion systems be constructed to study Lgt essentiality?

Construction of inducible deletion systems for studying Citrobacter koseri Lgt essentiality requires precise genetic engineering approaches to control gene expression. Based on successful systems with E. coli Lgt, researchers should employ a two-plasmid approach: one plasmid containing an arabinose-inducible copy of the lgt gene, and a second plasmid encoding an IPTG-inducible Cre recombinase . The chromosomal lgt gene should be modified to include loxP sites flanking the coding region. This system allows normal growth in the presence of arabinose (inducing lgt expression), while addition of IPTG activates Cre recombinase, leading to excision of the chromosomal lgt gene . Cell growth in liquid culture can be monitored by optical density measurements following withdrawal of arabinose and addition of IPTG to deplete Lgt. Colony forming unit (CFU) determination on solid media with and without arabinose provides quantitative assessment of viability loss upon Lgt depletion . Complementation experiments with plasmid-expressed wild-type lgt and point mutants help identify essential catalytic residues. Western blot analysis for lipoprotein processing intermediates confirms the molecular consequences of Lgt depletion, specifically detecting accumulation of unmodified prolipoprotein (UPLP) .

What phenotypic assays best quantify membrane defects after Lgt inhibition?

Multiple complementary phenotypic assays effectively quantify membrane defects resulting from Lgt inhibition in Citrobacter koseri, providing comprehensive assessment of physiological consequences. Membrane permeability assays using fluorescent dyes like propidium iodide or SYTOX Green offer quantitative measurement of outer membrane compromise, with increased fluorescence indicating greater permeabilization . Antibiotic susceptibility testing using gradient diffusion methods (E-test) or broth microdilution with diverse antibiotic classes (particularly large or hydrophobic compounds normally excluded by intact outer membranes) provides functional assessment of barrier disruption . Serum sensitivity assays measuring bacterial survival after exposure to complement proteins in human serum directly quantify the physiological consequence of outer membrane permeabilization . Microscopic analysis using phase contrast or electron microscopy visualizes characteristic membrane blebbing and increased cell size, which can be quantified through automated image analysis . For molecular-level assessment, SDS fractionation protocols separating peptidoglycan-associated proteins (PAP) from non-PAP fractions followed by Western blot detection of Lpp forms provides direct evidence of disrupted membrane-peptidoglycan linkage . Finally, measuring release of periplasmic enzymes like β-lactamase into culture supernatants offers another quantitative measure of membrane integrity loss .

How does Lgt inhibition affect interactions with host immune systems?

Lgt inhibition significantly alters bacterial interactions with host immune systems through multiple mechanisms affecting membrane integrity and lipoprotein presentation. Inhibition of Lgt in Gram-negative bacteria renders them substantially more sensitive to serum killing, indicating increased vulnerability to complement-mediated lysis . This heightened sensitivity stems from permeabilization of the outer membrane following disruption of proper lipoprotein anchoring, particularly affecting tethering of the outer membrane to peptidoglycan via lipoproteins like Lpp and Pal . The loss of diacylglyceryl modification on lipoproteins prevents their proper localization and function, compromising the physical barrier that normally protects bacteria from immune effectors . Additionally, altered lipoprotein processing likely changes the presentation of pathogen-associated molecular patterns (PAMPs) to pattern recognition receptors of the innate immune system, potentially enhancing recognition and inflammatory responses. From a therapeutic perspective, the increased outer membrane permeability following Lgt inhibition creates synergistic opportunities with other antimicrobials, as demonstrated by enhanced antibiotic susceptibility . This synergy could be particularly valuable in host environments where antibiotics alone may have limited efficacy due to poor penetration or local inactivation.

How conserved is Lgt structure and function across Gram-negative bacteria?

Lgt exhibits remarkable conservation in structure and function across diverse Gram-negative bacteria, including Citrobacter koseri, while maintaining specific sequence variations that might be exploited for species-selective targeting. The fundamental catalytic mechanism, involving transfer of a diacylglyceryl moiety from phosphatidylglycerol to the conserved cysteine in lipoprotein precursors, remains consistent across Gram-negative species . Key structural features, particularly the phosphatidylglycerol binding site, appear highly conserved, as evidenced by cross-species activity of Lgt inhibitors against both Escherichia coli and Acinetobacter baumannii . The essentiality of Lgt also persists across species, with depletion consistently leading to outer membrane permeabilization and increased sensitivity to serum killing and antibiotics . The substrate recognition pattern focusing on the lipobox motif ([LVI][ASTVI][GAS]C) is preserved across Gram-negative bacteria, though subtle preferences for specific amino acid combinations within this motif may exist between species . Interestingly, the phenotypic consequences of Lgt inhibition, particularly the inability of lpp deletion to rescue growth, also appear consistent across species, suggesting conserved downstream effects on cellular physiology beyond simple lipoprotein processing .

What protein engineering approaches optimize Citrobacter koseri Lgt for structural studies?

Optimizing Citrobacter koseri Lgt for structural studies requires strategic protein engineering approaches addressing the challenging properties of membrane-associated enzymes. Based on successful strategies with other bacterial membrane proteins, researchers should systematically truncate N- and C-terminal regions while preserving the catalytic core to identify minimal functional constructs with improved stability and crystallization properties. Introduction of surface entropy reduction mutations (replacing flexible, charged residues like lysine and glutamate with alanines) can enhance crystal packing . Fusion of crystallization chaperones such as T4 lysozyme or BRIL into predicted loop regions between transmembrane domains can provide additional crystal contacts without disrupting the core structure. To improve expression and purification yields, codon optimization for heterologous expression and incorporation of cleavable purification tags (His8-MBP or His8-SUMO) at the N-terminus significantly enhances solubility . For cryo-EM studies, increasing molecular weight through antibody fragment (Fab) complexes improves particle visualization. Thermal stability screening using differential scanning fluorimetry with various detergents, lipids, and buffer conditions identifies optimal stabilizing conditions for structural work . Finally, co-expression with stabilizing binding partners or nanobodies may lock the enzyme in specific conformational states relevant to the catalytic cycle.

How can researchers overcome solubility issues with recombinant Lgt?

Overcoming solubility challenges with recombinant Citrobacter koseri Lgt requires implementing multiple complementary strategies addressing the inherent properties of membrane proteins. First, expression construct optimization should include N-terminal fusion partners specifically designed for membrane proteins, such as Mistic or MBP-SUMO dual tags, which enhance folding and membrane insertion . Expression conditions require careful adjustment - lowering temperature to 16-18°C, reducing inducer concentration to 0.1-0.2 mM IPTG, and extending induction time to 16-20 hours significantly improves properly folded protein yields . The critical solubilization step should employ a detergent screen including n-dodecyl β-D-maltoside (0.02%) which successfully solubilized E. coli Lgt, along with other mild detergents like LMNG, DMNG, or detergent mixtures with cholesteryl hemisuccinate . Addition of specific phospholipids (0.01-0.05%) that mimic the native membrane environment, particularly phosphatidylglycerol which serves as a substrate for Lgt, stabilizes the protein during purification . For particularly challenging cases, cell-free expression systems with direct incorporation into nanodiscs or amphipols provides an alternative approach that completely bypasses inclusion body formation. Finally, genetic strategies like directed evolution for improved solubility or identification of thermostabilizing mutations through alanine scanning can generate optimized variants suitable for structural and functional studies .

What approaches help resolve inconsistent enzymatic activity in purified Lgt samples?

Resolving inconsistent enzymatic activity in purified Citrobacter koseri Lgt samples requires systematic troubleshooting of multiple factors affecting membrane protein function. First, detergent optimization is critical - researchers should test various detergent concentrations (0.01-0.05% range) and types, as excess detergent can strip essential boundary lipids while insufficient amounts may cause aggregation . Supplementation with specific phospholipids, particularly phosphatidylglycerol (1-5 mol%), often restores activity by replacing lipids lost during purification . Buffer composition significantly impacts activity - screening different pH values (6.5-8.5), salt concentrations (100-300 mM NaCl), and additives like glycerol (10-20%) and reducing agents (1-5 mM DTT) identifies optimal stability conditions . The presence of enzymatic co-factors should be verified, as contaminating phosphatases might degrade essential phospholipid substrates . Peptide substrate design requires careful consideration - synthetic peptides should include sufficient residues flanking the lipobox to ensure proper substrate recognition . Batch-to-batch variation can be controlled through rigorous standardization of expression and purification protocols, including consistent cell disruption methods and purification timeframes . For activity assays, implementing internal standards and careful control of temperature, incubation time, and substrate quality ensures reproducible results when measuring the release of glycerol phosphate using the coupled luciferase detection system .

How should researchers validate inhibitor specificity against Lgt?

Validating inhibitor specificity against Citrobacter koseri Lgt requires a multi-dimensional approach combining biochemical, genetic, and phenotypic methods to definitively establish on-target activity. Biochemically, researchers should directly measure inhibition of purified Lgt enzymatic activity using the glycerol phosphate release assay, establishing dose-response curves and IC50 values . Counter-screening against related enzymes in lipoprotein processing (LspA, Lnt) and other lipid-modifying enzymes confirms selectivity within and outside the pathway . At the genetic level, CRISPRi technology provides powerful validation by selectively decreasing gene expression of lgt, lspA, or lolC - compounds specifically targeting Lgt should demonstrate enhanced potency only in lgt-depleted strains . Western blot analysis of lipoprotein processing represents another critical validation approach, as Lgt inhibitors specifically cause accumulation of unmodified prolipoprotein (UPLP), a distinct molecular signature different from LspA or LolCDE inhibition . Phenotypic analyses should include microscopic evaluation for characteristic membrane blebbing and cell size changes consistent with Lgt inhibition . Resistance profiling provides additional validation, as lpp deletion rescues growth after LspA inhibition but not Lgt inhibition - this differential effect on lpp deletion mutants represents a definitive test for distinguishing between inhibitors of different lipoprotein processing enzymes .

How might cryo-EM techniques advance structural understanding of Lgt?

Cryo-electron microscopy (cryo-EM) represents a revolutionary approach for elucidating the structural details of Citrobacter koseri Lgt that have remained elusive through traditional crystallographic methods. Recent advances in single-particle cryo-EM now enable high-resolution structure determination of membrane proteins smaller than 100 kDa through strategic approaches enhancing visualization . For Lgt structural studies, researchers should employ antibody fragment (Fab) or nanobody complexes to increase molecular weight and provide feature recognition points during particle picking and alignment . Reconstitution into lipid nanodiscs rather than detergent micelles better preserves native-like lipid environments critical for Lgt function while providing a larger particle diameter for imaging . Advanced data collection strategies using energy filters, phase plates, and motion correction software significantly improve signal-to-noise ratios for smaller membrane proteins . Most importantly, cryo-EM facilitates capture of multiple conformational states representing the complete catalytic cycle - substrate-bound, transition state, and product-release conformations - providing unprecedented insights into the mechanism of diacylglyceryl transfer . Combined with molecular dynamics simulations, these structures would reveal how phosphatidylglycerol and peptide substrates access the active site through the membrane interface, defining the molecular basis for the conservation that has made development of on-target resistant mutants challenging .

What implications does Lgt inhibition have for combination antimicrobial therapy?

Lgt inhibition presents compelling opportunities for combination antimicrobial therapy against Citrobacter koseri infections through multiple synergistic mechanisms targeting bacterial membrane integrity. Research demonstrates that Lgt depletion significantly sensitizes bacteria to serum killing and various antibiotics by compromising outer membrane barrier function . This membrane permeabilization effect creates potential synergies with antibiotics normally excluded by the Gram-negative outer membrane, particularly large glycopeptides, lipoglycopeptides, and hydrophobic compounds . Unlike other lipoprotein processing enzymes, the unique resistance profile of Lgt inhibitors - specifically that lpp deletion does not rescue growth after Lgt inhibition - suggests combinations would remain effective even as resistance develops to other membrane-targeting agents . Strategic combination approaches should include pairing Lgt inhibitors with: (1) antibiotics targeting intracellular processes that normally have limited penetration, (2) host defense peptides that exploit the compromised membrane integrity, and (3) existing clinical antibiotics to revitalize effectiveness against resistant strains . In vivo infection models particularly relevant for Citrobacter koseri would include urinary tract infection models, given its prominence as a uropathogen similar to the E. coli strains where Lgt depletion has demonstrated efficacy . These combinations could potentially address the significant clinical challenge of multidrug-resistant Citrobacter koseri infections, particularly in healthcare settings and immunocompromised patients.

How might emerging synthetic biology approaches enhance Lgt inhibitor development?

Emerging synthetic biology approaches offer unprecedented opportunities to accelerate and enhance Citrobacter koseri Lgt inhibitor development through multiple innovative strategies. Cell-free expression systems provide rapid production of functional Lgt enzyme outside cellular constraints, enabling high-throughput screening in membrane-mimetic environments optimized for activity . Directed evolution platforms coupling Lgt function to selectable phenotypes can generate enzyme variants with altered inhibitor sensitivity, providing insights into resistance mechanisms and binding determinants . High-density mutagenesis combined with deep sequencing creates comprehensive maps of mutation effects on enzyme function and inhibitor sensitivity, identifying non-obvious binding sites and allosteric networks . Biosensor development using transcriptional reporters linked to Lgt activity enables whole-cell screening approaches in native bacterial contexts . Chemically expanded genetic codes incorporating unnatural amino acids at specific positions in Lgt create precision-engineered enzymes with photocrosslinking or click chemistry handles for direct inhibitor binding studies . Microfluidic droplet systems encapsulating individual bacteria expressing Lgt variants allow ultra-high-throughput screening of millions of enzyme-inhibitor combinations simultaneously . Finally, machine learning approaches integrating structural, biochemical, and phenotypic data can predict optimized inhibitor structures with improved potency and specificity profiles, dramatically accelerating the medicinal chemistry optimization process . These technologies collectively overcome traditional bottlenecks in membrane protein drug discovery, potentially yielding novel Lgt inhibitor classes with properties suitable for clinical development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.