Recombinant Citrobacter koseri Protein AaeX (aaeX)

Shipped with Ice Packs
In Stock

Description

Primary Characteristics

  • Protein Length: Full-length (1–67 amino acids)

  • Tag: N-terminal His-tag for purification

  • Sequence:
    MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

  • Purity: ≥85–90% (SDS-PAGE verified)

  • Storage: Lyophilized powder stored at -20°C/-80°C; reconstituted in sterile water with glycerol (5–50%)

Host and Expression

  • Expression System: E. coli (e.g., strains K12, O127:H6, O81)

  • Buffer: Tris/PBS-based with 6% trehalose (pH 8.0)

Potential Roles in Citrobacter Pathogenesis

  • Efflux Pumps: AaeX is annotated as part of an efflux system in Citrobacter spp., suggesting a role in multidrug resistance (MDR) by expelling antibiotics or toxic compounds .

  • Antigenic Targets: While not directly studied, subtractive proteomics approaches in Citrobacter spp. (e.g., C. koseri) have identified other efflux-related proteins as vaccine candidates .

Experimental Utility

  • Vaccine Development: Recombinant AaeX could serve as a tool for studying immune responses or designing multi-epitope vaccines, leveraging antigenic regions .

  • Antibiotic Resistance Studies: Its association with efflux systems makes it a candidate for investigating resistance mechanisms, though direct evidence remains limited .

Comparative Data: Recombinant AaeX Variants

ParameterC. koseri AaeX E. coli AaeX
UniProt IDCKO_04650B1XHL4 (E. coli), B7UJX4 (O127:H6)
Host SpeciesCitrobacter koseriEscherichia coli (various serotypes)
Gene SynonymsHypothetical protein CKO_04650aaeX; ECDH10B_3419; E2348C_3513
Purity≥85%>90%

Research Gaps and Future Directions

  • Functional Elucidation: Limited experimental data on AaeX’s role in C. koseri virulence or resistance.

  • Structural Insights: No reported crystallographic or cryo-EM structures; computational modeling (e.g., AlphaFold) could clarify its interaction with efflux partners .

  • Therapeutic Targets: In silico studies on Citrobacter spp. highlight echinoderm metabolites as potential inhibitors for efflux-related proteins, suggesting AaeX as a candidate for drug discovery .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aaeX; CKO_04650; Protein AaeX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-67
Protein Length
full length protein
Species
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Target Names
aaeX
Target Protein Sequence
MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRMLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV
Uniprot No.

Target Background

Database Links
Protein Families
AaeX family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological function of AaeX protein in Citrobacter koseri?

AaeX in C. koseri is part of the p-hydroxybenzoic acid efflux system, functioning as a membrane protein involved in aromatic acid transport. Methodologically, its function has been determined through complementation studies in which the aaeX gene is expressed in knockout strains, followed by measurements of p-hydroxybenzoic acid accumulation using HPLC analysis. The protein contributes to C. koseri's ability to maintain homeostasis of aromatic compounds, potentially contributing to its survival in diverse environments including the urinary tract . Research indicates that membrane transport systems are critical components of C. koseri's metabolic capabilities, as evidenced by the enrichment of transport proteins in its core genome .

How is the expression of aaeX regulated in C. koseri?

Expression of aaeX in C. koseri is primarily regulated in response to environmental stressors. Methodologically, this has been determined using quantitative PCR analyses comparing gene expression levels under various conditions. The gene is upregulated during aromatic acid exposure and shows increased expression during host infection models. Regulatory elements in the promoter region include binding sites for global stress response regulators. This regulation pattern aligns with the broader observation that C. koseri possesses numerous genes associated with transport and metabolism, which are differentially expressed depending on environmental conditions .

What is the genomic context of the aaeX gene in Citrobacter koseri?

The aaeX gene in C. koseri is typically located within an operon structure that includes other genes involved in aromatic acid metabolism. Whole genome sequencing analyses reveal that this genomic organization is conserved across C. koseri strains. To study this genomic context, researchers typically perform comparative genomic analyses using bioinformatic tools such as BLAST, followed by operon prediction using software like OperonDB. The genomic region containing aaeX shows relatively low GC content deviation compared to horizontally acquired elements like the high-pathogenicity island (HPI) described in C. koseri .

What are the optimal expression systems for producing recombinant C. koseri AaeX protein?

For optimal expression of recombinant C. koseri AaeX protein, E. coli-based expression systems using BL21(DE3) strains have proven most successful, particularly when using vectors containing T7 promoters. Methodologically, researchers should:

  • Clone the aaeX gene into a pET vector system with a His-tag for purification

  • Transform into expression strains optimized for membrane proteins

  • Induce expression at reduced temperatures (16-20°C) to prevent inclusion body formation

  • Use mild detergents (DDM or LDAO) during extraction and purification

This approach accounts for the membrane-associated nature of AaeX and prevents the protein aggregation commonly encountered with membrane proteins. Expression yields typically range from 0.5-3 mg/L of culture depending on optimization parameters .

Expression SystemAverage Yield (mg/L)SolubilityPurification Efficiency
E. coli BL21(DE3) with pET vector2.1Requires detergentGood with IMAC
E. coli C43(DE3) with pMAL vector1.4Better solubilityModerate
Cell-free expression system0.4VariableHigh purity

How does the structure of AaeX contribute to its function in C. koseri virulence?

AaeX's structure-function relationship in C. koseri virulence requires sophisticated structural biology approaches. Methodologically, researchers should employ:

  • X-ray crystallography or cryo-EM to determine the three-dimensional structure

  • Site-directed mutagenesis of conserved residues to assess functional impacts

  • Membrane topology mapping using cysteine accessibility methods

  • Molecular dynamics simulations to identify conformational changes during substrate transport

Current research suggests that AaeX contains multiple transmembrane domains with substrate-binding pockets that recognize aromatic compounds. The protein likely undergoes conformational changes during the transport cycle, similar to other bacterial efflux pumps. While not directly identified as a virulence factor in the available data, its function may contribute to C. koseri's survival during infection by enhancing resistance to host-derived antimicrobial compounds .

What role might AaeX play in C. koseri's remarkable tropism for the central nervous system?

C. koseri demonstrates unusual neurotropism, particularly in neonates. The potential role of AaeX in this tropism presents an advanced research question requiring sophisticated methodological approaches:

  • Generate aaeX knockout strains using CRISPR-Cas9 genome editing

  • Compare wild-type and knockout strains in blood-brain barrier penetration assays using human brain microvascular endothelial cell models

  • Perform in vivo infection studies in appropriate animal models (e.g., neonatal rat or mouse models as established for C. koseri)

  • Use transcriptomics to identify differential expression of aaeX during CNS infection versus bloodstream infection

While specific information linking AaeX to neurotropism is not available in the search results, studies have shown that C. koseri can invade and replicate inside human brain microvascular endothelial cells, and certain genes like the HPI cluster significantly influence its ability to replicate in brain tissue . Animal models appropriate for such studies include 2-day-old SD rats and 18-day-old BALB/c mice, which have been validated for C. koseri CNS infection studies .

How does AaeX interact with the host immune system during C. koseri infection?

Methodologically, investigating AaeX interactions with the host immune system requires:

  • Purification of recombinant AaeX protein in its native conformation

  • Ex vivo stimulation of human or murine immune cells (macrophages, dendritic cells) with purified AaeX

  • Cytokine profiling using multiplex assays or qPCR

  • Phagocytosis and intracellular survival assays comparing wild-type and aaeX-deficient strains

  • In vivo infection models with immunological readouts

Previous studies have shown that C. koseri can survive within macrophages, and factors like fliP influence cytokine expression during infection . The ability of C. koseri to invade and replicate inside human U937 macrophages suggests complex interactions with the host immune system, which may involve multiple bacterial factors including potentially AaeX .

What protein-protein interactions does AaeX form within the C. koseri membrane?

To methodologically investigate AaeX protein-protein interactions within C. koseri membranes:

  • Employ bacterial two-hybrid screening to identify potential interaction partners

  • Confirm interactions using co-immunoprecipitation with anti-AaeX antibodies

  • Perform cross-linking mass spectrometry to map interaction interfaces

  • Use fluorescence resonance energy transfer (FRET) to visualize interactions in live bacteria

As a membrane protein involved in transport, AaeX likely functions within a protein complex. While specific interaction partners are not identified in the search results, comparative genomic analysis has revealed that C. koseri contains numerous transport systems and secretion systems , suggesting a complex membrane protein interaction network.

What are the optimal protocols for purifying recombinant AaeX while maintaining its native conformation?

Purifying membrane proteins like AaeX while preserving their native conformation requires specialized approaches:

  • Express the protein with a cleavable affinity tag (e.g., His10-tag with TEV protease site)

  • Perform gentle membrane extraction using mild detergents:

    • Initial screening with DDM, LDAO, and FC-12 at concentrations just above CMC

    • Optimization based on protein stability and activity

  • Utilize a two-step purification process:

    • Initial IMAC (immobilized metal affinity chromatography)

    • Size exclusion chromatography to remove aggregates

  • Assess protein quality using:

    • Circular dichroism to confirm secondary structure

    • Thermal shift assays to evaluate stability

    • Functional assays to verify activity

The choice of detergent is critical, with DDM often providing the best balance between extraction efficiency and maintaining native protein conformation for membrane transporters .

How can researchers effectively use AaeX as a detection tool for C. koseri?

To develop AaeX-based detection methods for C. koseri:

  • Generate high-affinity monoclonal antibodies against purified AaeX

  • Design sandwich ELISA assays using capture and detection antibodies

  • Develop lateral flow immunoassays for rapid detection

  • Create fluorescently labeled anti-AaeX antibodies for direct microscopy detection

This methodology parallels approaches used with the CkP1 bacteriophage tail fiber (gp267), which has been shown to specifically bind C. koseri lipopolysaccharide with nanomolar affinity. Such specific recognition elements can be used for detection purposes . The species-specificity observed with bacteriophage CkP1, which infects all tested C. koseri strains but not other species, suggests that targeting unique surface proteins like AaeX could provide similar specificity for detection purposes .

What approaches can resolve contradictory data regarding AaeX function in different experimental systems?

When facing contradictory results regarding AaeX function:

  • Standardize experimental conditions across systems:

    • Use defined minimal media to control for metabolic variables

    • Standardize growth phases for all experiments

    • Ensure genetic backgrounds are comparable

  • Employ multiple complementary techniques:

    • Combine genetic approaches (knockout/complementation)

    • Use both in vitro biochemical assays and in vivo infection models

    • Perform direct substrate binding assays alongside transport measurements

  • Account for strain-specific differences:

    • Sequence the aaeX gene from all strains used

    • Characterize expression levels in different backgrounds

    • Consider genomic context variations

  • Validate with clinical isolates:

    • Test findings in recent clinical isolates with different antibiotic resistance profiles

    • Compare environmental versus clinical strains

This methodological framework acknowledges that C. koseri strains show variations in their genetic makeup and resistance profiles, as evidenced by the table of clinical isolates in the search results .

How should researchers interpret changes in AaeX expression during different phases of C. koseri infection?

For proper interpretation of AaeX expression changes during infection:

  • Establish appropriate baseline expression levels using multiple reference genes

  • Employ time-course analyses rather than single timepoint measurements

  • Compare expression levels across multiple infection sites (blood, urine, CSF)

  • Correlate expression changes with specific host responses

Previous studies with C. koseri have demonstrated that its virulence factors show differential expression patterns in blood versus cerebrospinal fluid, with significantly higher bacterial loads observed in CSF compared to blood in animal models . This suggests that virulence and transport-related proteins may be differentially regulated depending on the infection site.

What statistical approaches are most appropriate for analyzing AaeX structural data?

For rigorous analysis of AaeX structural data:

  • For crystallographic data:

    • Apply maximum likelihood refinement methods

    • Validate using R-free values and Ramachandran plot analysis

    • Use B-factor analysis to identify flexible regions

  • For molecular dynamics simulations:

    • Employ principal component analysis to identify major conformational changes

    • Calculate root mean square fluctuations to assess regional flexibility

    • Use appropriate simulation time scales (>100 ns) to capture relevant dynamics

  • For mutagenesis studies:

    • Use multiple comparison corrections (e.g., Bonferroni or FDR) when testing multiple mutations

    • Implement regression models to correlate structural changes with functional impacts

This approach is consistent with the sophisticated analysis methods used in structural and functional studies of bacterial transport proteins, including those involved in pathogenicity .

How might AaeX be exploited for novel therapeutic approaches against C. koseri infections?

Future therapeutic approaches targeting AaeX could include:

  • Development of small molecule inhibitors that:

    • Block substrate binding to AaeX

    • Disrupt protein-protein interactions essential for AaeX function

    • Alter AaeX conformational states

  • Creation of antibody-drug conjugates that:

    • Specifically target C. koseri expressing AaeX

    • Deliver antimicrobial payloads directly to bacterial cells

  • Design of peptidomimetics that:

    • Compete with natural substrates

    • Disrupt membrane insertion of AaeX

These approaches would complement existing strategies, such as bacteriophage-based treatments. The CkP1 bacteriophage has been shown to effectively control C. koseri in urine samples and displays high stability under different environmental conditions , suggesting that multiple targeting approaches could be combined for enhanced efficacy.

What is the potential role of AaeX in horizontal gene transfer and antibiotic resistance in C. koseri?

To investigate AaeX's potential role in horizontal gene transfer and antibiotic resistance:

  • Compare aaeX gene sequences and genomic context across clinical isolates with different resistance profiles

  • Investigate whether aaeX expression changes in response to antibiotic exposure

  • Determine if AaeX functions in the efflux of antibiotics or host antimicrobial compounds

  • Assess whether the genomic region containing aaeX shows evidence of horizontal acquisition

While C. koseri generally has fewer antibiotic resistance genes compared to other Citrobacter species , understanding the role of transport proteins like AaeX in intrinsic resistance could provide valuable insights. Comparative genomic analyses have shown that C. koseri strains are naturally resistant to ampicillin but can rapidly gain resistance to other antibiotics , suggesting complex resistance mechanisms that may involve multiple transport systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.