Recombinant Citrobacter koseri Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

Recombinant Production

Expression Systems:

  • Hosts: Escherichia coli, yeast, baculovirus, or mammalian cells .

  • Yield: 1–2.5 mg per liter of culture .

Purification Protocol:

  1. Induction: Optimized with arabinose (0.002–0.2%) at 25–37°C .

  2. IMAC: Nickel-affinity chromatography for His-tagged GlpG .

  3. SEC: Size-exclusion chromatography to ensure monodispersity .

Critical Notes:

  • Avoid repeated freeze-thaw cycles; working aliquots stable at 4°C for ≤1 week .

Catalytic Mechanism

Hydrolytic Activity:

  • Utilizes a Ser-201/His-254 dyad to form a tetrahedral transition state during proteolysis .

  • Inhibitors:

    • Diisopropyl fluorophosphonate (DFP): Irreversibly inhibits via covalent Ser-201 binding (IC₅₀: 5 µM) .

    • 3,4-Dichloroisocoumarin (DCI): Blocks activity through dual covalent bonds to Ser-201/His-254 .

Membrane Protein Quality Control:

  • Cleaves orphan subunits of respiratory complexes (e.g., hydrogenase-2, formate dehydrogenase) to prevent cytotoxic accumulation .

  • Substrate specificity depends on partner protein absence; functional complexes are protected .

Role in Bacterial Fitness:

  • In Escherichia coli, GlpG promotes gut persistence by enhancing fatty acid β-oxidation and glycerol degradation .

  • ΔglpG mutants show >120-fold reduced survival in murine gut colonization assays .

Research Applications

Functional Studies:

  • Used to investigate intramembrane proteolysis mechanisms .

  • Substrate profiling reveals roles in bacterial stress adaptation .

Therapeutic Potential:

  • Target for antimicrobials due to its role in pathogen persistence .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are open to fulfilling any special format requirements you may have. Please specify your desired format in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs by default. Should you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
glpG; CKO_04842; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Target Names
glpG
Target Protein Sequence
MLMITSFANPRVAQAFVDYMATQGVILTIQQHHQSDVWLADESQAERVRAELARFLENPA DPRYLAASWQSGHTGSGLHYRRFPFIATLRERAGPVTWLIMIACILVFVVMSIVGAQSVM VWLAWPFDPSLKFEFWRYFTHAFMHFSLMHILFNLLWWWYIGGAVEKRLGSGKLIVITVI SALLSGYVQQKFSGPWFGGLSGVVYALMGYAWLRGERDPQSGIYLQRGLIAFALIWIVAG WFDVFGMSMANGAHIAGLAVGLAMAFADTVNARKRT
Uniprot No.

Target Background

Function
Rhomboid-type serine protease that catalyzes intramembrane proteolysis.
Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does C. koseri glpG differ from other bacterial rhomboid proteases?

C. koseri glpG shares structural similarities with other bacterial rhomboid proteases, particularly those from Enterobacteriaceae, but exhibits species-specific sequence variations. While the catalytic mechanism is conserved, substrate specificity may differ.

Comparative analysis reveals:

  • The C. koseri glpG preserves the core six-transmembrane helix architecture found in the well-studied E. coli GlpG

  • The active site residues (serine and histidine) are conserved across species

  • Loop regions exhibit greater sequence divergence, which may influence substrate recognition

  • C. koseri glpG contains specific residues that may confer unique regulatory properties compared to other bacterial homologs

These differences may reflect adaptations to the specific biological context of C. koseri, including its occasional role as an opportunistic pathogen.

What is known about the genetic context of glpG in Citrobacter koseri?

The glpG gene in C. koseri is positioned within a conserved genomic region found in many Enterobacteriaceae. The gene is designated as CKO_04842 in the genome of C. koseri strain ATCC BAA-895 / CDC 4225-83 / SGSC4696.

Key genetic features include:

  • The gene exists as a single copy in the C. koseri genome

  • It is likely part of an operon involved in glycerol metabolism, similar to E. coli

  • Genomic analyses suggest that C. koseri populations are nonclonal, with considerable genetic diversity across isolates

  • No specific genetic variants of glpG have been associated with increased virulence or specific clinical manifestations to date

This genetic context provides important insights for researchers designing genetic manipulation experiments or studying regulatory mechanisms of glpG expression.

What is the predicted structural organization of C. koseri glpG and how does it relate to function?

The C. koseri rhomboid protease glpG is predicted to have a six-transmembrane helical structure typical of rhomboid proteases, with the active site located within the membrane bilayer. Based on homology to well-characterized rhomboid proteases:

  • The protein likely contains six transmembrane α-helices (TM1-TM6)

  • A catalytic dyad of serine (in TM4) and histidine (in TM6) forms the active site

  • A "cap" loop between TM1 and TM2 may regulate substrate access

  • A periplasmic loop between TM5 and TM6 may influence substrate recognition

The functional significance of this structure includes:

  • The transmembrane architecture creates a hydrophilic environment within the membrane for catalysis

  • Substrate gating mechanisms control access to the active site

  • The specific arrangement of transmembrane helices creates a lateral opening that allows substrate entry

These structural features are critical for understanding the protein's mechanism of action and for designing experiments to probe structure-function relationships.

How does the lipid environment affect C. koseri glpG activity and what methods exist to study this interaction?

The lipid environment significantly influences rhomboid protease activity through multiple mechanisms:

  • Membrane thickness effects: Thinner membranes generally enhance activity by reducing hydrophobic mismatch

  • Lipid charge effects: Negatively charged lipids may affect protein orientation in membranes

  • Specific lipid interactions: Certain lipids may directly interact with specific sites on the protein

Methodological approaches to study these interactions include:

MethodApplicationAdvantagesLimitations
Reconstitution in proteoliposomesActivity assays in defined lipid environmentsControlled composition, near-native conditionsComplex preparation, potential artifacts
Fluorescence quenchingDetermining protein orientation in membranesIndependent of protein function, quantitativeRequires site-specific labeling
Native mass spectrometryIdentifying specifically bound lipidsDirect detection of protein-lipid complexesLimited to stable interactions
Molecular dynamics simulationsPredicting lipid interactionsAtomic-level detail, time-resolvedComputational limitations, validation required

Research has shown that rhomboid proteases like GlpG show a "lipid dependency" that affects both orientation and activity when reconstituted in liposomes with different lipid compositions . For example, studies with E. coli GlpG demonstrated that the presence of negatively charged phospholipids can significantly alter its orientation in synthetic membranes, which directly impacts function.

What are the current hypotheses regarding the physiological substrates of C. koseri glpG?

The physiological substrates of C. koseri glpG remain largely uncharacterized, though several hypotheses exist based on homology to better-studied bacterial rhomboid proteases:

  • Membrane protein quality control: glpG may participate in degrading misfolded membrane proteins

  • Quorum sensing regulation: Processing of signaling peptides involved in bacterial communication

  • Virulence factor processing: Potential role in activating or regulating virulence-associated proteins

Experimental approaches to substrate identification include:

  • Candidate-based approaches testing known substrates of related rhomboid proteases

  • Proteomics-based identification of accumulated substrates in glpG deletion mutants

  • In vitro cleavage assays with synthetic transmembrane peptides

  • Genetic screens for synthetic phenotypes with putative substrate mutants

The identification of physiological substrates remains a significant knowledge gap and represents an important research direction for understanding the biological function of this enzyme in C. koseri.

What are the optimal conditions for expressing and purifying recombinant C. koseri glpG?

Successful expression and purification of membrane proteins like rhomboid proteases require careful optimization. For C. koseri glpG, researchers should consider:

Expression systems:

  • E. coli: Most commonly used, with specialized strains like C41(DE3) or C43(DE3) designed for membrane protein expression

  • Cell-free systems: Allow direct incorporation into nanodiscs or liposomes

  • Yeast expression: Alternative for proteins that are toxic in bacterial systems

Expression optimization:

  • Lower induction temperatures (16-25°C) to slow expression and facilitate proper folding

  • Induction at lower cell densities to prevent inclusion body formation

  • Addition of specific lipids to the growth medium

Purification strategy:

  • Membrane isolation by ultracentrifugation

  • Solubilization with mild detergents (DDM, LMNG, or GDN typically preserve activity)

  • Immobilized metal affinity chromatography (IMAC) using a histidine tag

  • Size exclusion chromatography for final polishing

Storage considerations:

  • Storage at -20°C or -80°C with 50% glycerol in Tris-based buffer as indicated for commercial preparations

  • Avoiding repeated freeze-thaw cycles

  • Consider storage of working aliquots at 4°C for up to one week

The choice of tag and purification strategy should be optimized based on the specific experimental requirements and downstream applications.

How can researchers design valid activity assays for C. koseri glpG?

Designing robust activity assays for rhomboid proteases presents unique challenges due to their intramembrane nature. Several methodological approaches are available:

In vitro activity assays:

  • Detergent-based assays: Using solubilized enzyme and substrates in detergent micelles

    • Advantages: Simplicity, quantitative analysis

    • Limitations: Non-native environment may alter activity

  • Liposome reconstitution systems: Embedding both enzyme and substrate in proteoliposomes

    • Advantages: Better mimics native membrane environment

    • Limitations: More complex preparation, potential orientation issues

  • Nanodiscs or bicelles: Provide a defined membrane patch with better stability

    • Advantages: Defined size, improved stability

    • Limitations: Higher technical complexity

Detection methods:

  • FRET-based substrates with fluorophore/quencher pairs

  • Western blotting using antibodies against substrate or cleavage products

  • Mass spectrometry to identify cleavage sites precisely

Controls and validation:

  • Inactive mutants (typically S→A mutation in the catalytic serine)

  • Comparison with well-characterized rhomboid proteases (e.g., E. coli GlpG)

  • Testing known inhibitors of rhomboid proteases

When working with proteoliposomes, researchers should consider the orientation of the protease, as this significantly affects the accessibility of substrates. Techniques like fluorescence quenching can be used to determine protein orientation in reconstituted systems .

What genetic tools and approaches are recommended for studying C. koseri glpG function in vivo?

Genetic manipulation of C. koseri to study glpG function requires specialized approaches due to its occasional role as an opportunistic pathogen. Several methodological strategies include:

Gene knockout/modification techniques:

  • Homologous recombination: Traditional approach using antibiotic resistance cassettes

    • Example: Similar to the approach used in the S. gordonii study where genes were replaced with a spectinomycin resistance cassette

  • CRISPR-Cas9 systems: More precise genetic editing with reduced polar effects

    • Advantages: Reduced off-target effects, potential for scarless modifications

  • Inducible expression systems: For studying essential genes or controlling expression levels

    • Options include tetracycline-inducible or arabinose-inducible systems

Phenotypic analysis:

  • Growth curves under various stress conditions

  • Biofilm formation assays

  • Proteomics to identify accumulated substrates

  • Virulence assays using appropriate model systems

Complementation strategies:

  • Plasmid-based expression systems should consider copy number effects

  • Chromosomal integration at neutral sites

  • Expression of the target gene with native promoter elements to maintain physiological regulation

When designing genetic studies, researchers should be aware of potential polar effects on downstream genes, as seen in the S. gordonii study where mutation in one gene affected expression of downstream genes .

How might C. koseri glpG contribute to bacterial pathogenesis and what experimental approaches can address this question?

C. koseri is an opportunistic pathogen associated with meningitis and brain abscesses, particularly in neonates. While the specific role of glpG in pathogenesis remains unexplored, several investigative approaches can address this question:

Potential roles in pathogenesis:

  • Processing of adhesins or invasins required for host cell interaction

  • Regulation of membrane protein composition affecting antibiotic resistance

  • Modulation of stress responses during host colonization

  • Processing of signaling molecules that regulate virulence gene expression

Experimental approaches:

  • Infection models:

    • Cell culture invasion and survival assays

    • Animal models of C. koseri infection comparing wild-type and glpG mutants

  • Virulence determinant analysis:

    • Comparative proteomics of wild-type vs. glpG mutant membrane fractions

    • Transcriptomics under infection-relevant conditions

  • Host-pathogen interaction studies:

    • Adhesion and invasion assays with epithelial or immune cells

    • Biofilm formation capacity relating to medical device colonization

Of particular interest is the finding that C. koseri has been associated with platelet concentrate contamination, with lethal consequences in some cases . The role of glpG in survival in blood products represents a specific research question with clinical relevance.

What structural comparison methods can reveal insights into substrate specificity differences between C. koseri glpG and other rhomboid proteases?

Understanding substrate specificity requires sophisticated structural analysis techniques:

Comparative structural approaches:

  • Homology modeling: Using solved structures (e.g., E. coli GlpG) as templates

    • Validation through molecular dynamics simulations

    • Analysis of active site architecture and substrate-binding pockets

  • X-ray crystallography or cryo-EM: Direct structural determination

    • Co-crystallization with inhibitors or substrate mimics

    • Analysis of conformational states

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Maps dynamic regions and solvent accessibility

    • Can identify substrate-binding regions

  • Computational docking and molecular dynamics:

    • Predicts substrate binding modes

    • Simulates enzyme-substrate interactions in membrane environments

Structure-function analysis through mutations:

  • Swapping residues between different rhomboid proteases to transfer specificity

  • Alanine-scanning mutagenesis of predicted substrate-contacting residues

  • Construction of chimeric enzymes combining domains from different rhomboid proteases

These approaches can illuminate how subtle structural differences between rhomboid proteases translate to functional diversity across bacterial species.

What are the current gaps in understanding the regulation of C. koseri glpG expression and activity?

Several significant knowledge gaps exist regarding regulation of C. koseri glpG:

Transcriptional regulation:

  • Identity of transcription factors controlling glpG expression

  • Environmental signals that modulate expression (pH, temperature, nutrient availability)

  • Potential co-regulation with genes involved in glycerol metabolism or stress responses

Post-translational regulation:

  • Activation mechanisms - whether the protein requires processing for activity

  • Inhibitory mechanisms - potential endogenous inhibitors

  • Protein-protein interactions that may modulate activity

  • Impact of membrane lipid composition on activity in vivo

Experimental approaches to address these gaps:

  • Promoter-reporter fusion assays to identify regulatory elements

  • Chromatin immunoprecipitation to identify transcription factor binding

  • Metabolic labeling to study protein turnover and processing

  • Lipidomic analysis correlated with enzyme activity measurements

Understanding these regulatory mechanisms would provide insights into the physiological context of glpG function and potentially reveal new approaches to modulate its activity for research or therapeutic purposes.

How does C. koseri glpG fit into the evolutionary context of rhomboid proteases?

Rhomboid proteases represent one of the most conserved protease families across all domains of life. The C. koseri glpG can be contextualized within this evolutionary framework:

Evolutionary relationships:

  • C. koseri glpG belongs to the prokaryotic rhomboid proteases clade

  • It shares highest sequence similarity with rhomboid proteases from related Enterobacteriaceae

  • The catalytic mechanism is conserved from bacteria to humans, suggesting ancient evolutionary origins

  • Loop regions show higher sequence divergence, reflecting adaptations to specific cellular environments

Genomic context conservation:

  • In many Enterobacteriaceae, glpG is associated with genes involved in glycerol metabolism

  • The gene order and orientation show conservation within related bacterial families

  • Comparative genomics suggests the nonclonal nature of C. koseri populations

Functional evolution:

  • Substrate specificity may have evolved to accommodate species-specific requirements

  • Regulatory mechanisms likely reflect adaptation to specific ecological niches

  • The conservation of this enzyme suggests fundamental cellular roles beyond species-specific functions

This evolutionary perspective helps researchers interpret functional data and design comparative studies that leverage conservation patterns to identify critical functional elements.

What methodological approaches are most effective for studying potential horizontal gene transfer events involving glpG genes?

Investigating horizontal gene transfer (HGT) of rhomboid protease genes requires specialized comparative genomic approaches:

Detection methods for HGT:

  • Phylogenetic incongruence analysis:

    • Comparing glpG gene trees with species trees

    • Statistical tests for topology differences

  • Compositional bias detection:

    • Analysis of GC content, codon usage, and oligonucleotide frequencies

    • Identification of regions differing from genomic background

  • Comparative genomic context analysis:

    • Examination of synteny conservation

    • Identification of mobile genetic element signatures

Tools and resources:

  • Genome databases with diverse bacterial isolates

  • Phylogenomic software packages (e.g., PhyloBayes, IQ-TREE)

  • Specialized HGT detection software (e.g., HGTector, Darkhorse)

Case study approach:
The study of C. koseri platelet concentrate contamination provides an example of genomic approaches to bacterial population analysis. The research showed that despite multiple contamination events, there was no evidence for a specific clone responsible for these events . Similar methodologies could be applied to study the evolution and potential transfer of glpG genes.

How do structure-function relationships in C. koseri glpG compare with distant rhomboid protease homologs from other kingdoms?

Rhomboid proteases show remarkable structural conservation despite sequence divergence across evolutionary distances. Comparing C. koseri glpG with homologs from other kingdoms reveals:

Conserved structural elements:

Divergent features:

  • Loop regions between transmembrane helices

  • Regulatory domains found in some eukaryotic rhomboids but absent in prokaryotic homologs

  • Accessory subunits that modulate activity in complex eukaryotic systems

Methodological approaches for comparative studies:

  • Structural alignments of solved crystal structures

  • Conservation mapping onto three-dimensional models

  • Functional complementation experiments across species

  • Domain swapping between distant homologs to identify specificity determinants

These comparative analyses can provide insights into the essential functional core of rhomboid proteases while highlighting adaptations that reflect kingdom-specific roles and regulatory mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.