Recombinant Citrobacter koseri Spermidine export protein MdtI (mdtI)

What is Citrobacter koseri Spermidine export protein MdtI?

Citrobacter koseri Spermidine export protein MdtI is a membrane protein belonging to the small multidrug resistance (SMR) family of transporters. It functions as part of a protein complex (MdtJI) responsible for the excretion of spermidine from bacterial cells. The protein is encoded by the mdtI gene and plays a crucial role in polyamine homeostasis in Citrobacter koseri, a Gram-negative bacillus of the Enterobacteriaceae family . The protein is 109 amino acids in length and contributes to the bacteria's ability to maintain appropriate intracellular polyamine levels, which is essential for normal bacterial growth and survival under various environmental conditions .

What is the amino acid sequence and structural characteristics of MdtI protein?

The amino acid sequence of Citrobacter koseri Spermidine export protein MdtI is:
MPQFEWVHAAWLAMAIVLEIVANVFLKFSDGFRRKFYGILSLAAVLAAFSALSQAVKGIDLSVAYALWGGFGIAATLAAGWVLFGQRLNNKGWVGVVLLLIGMIMIKLA

This 109-amino acid protein contains multiple hydrophobic regions consistent with its function as a membrane transporter. Structural analysis suggests MdtI contains transmembrane domains that form a channel or pore through which spermidine is exported. Several key amino acid residues, including glutamic acid (E) residues, appear to be critical for its transport function, as research on homologous proteins in E. coli indicates that residues such as Glu5, Glu19, and Asp60 are involved in the excretion activity of MdtI .

How does the MdtJI complex function in polyamine transport?

The MdtJI complex functions as a spermidine exporter that helps maintain polyamine homeostasis in bacterial cells. Studies in E. coli have shown that both MdtJ and MdtI proteins are necessary for spermidine export function - neither protein alone is sufficient for this activity . The complex catalyzes the excretion of spermidine from cells, particularly when intracellular spermidine levels become excessive and potentially toxic.

Research demonstrates that expression of mdtJI can enhance cell viability and growth through excretion of spermidine when it overaccumulates in bacterial cells. This mechanism was confirmed when E. coli cells cultured with high concentrations of spermidine (2-12 mM) showed significantly improved growth and viability when expressing the mdtJI genes compared to control cells . The spermidine content in cells expressing MdtJI was greatly diminished, confirming its role in polyamine export.

What are the optimal storage conditions for recombinant MdtI protein?

For optimal stability, recombinant Citrobacter koseri Spermidine export protein MdtI should be stored at -20°C, and for extended storage, it should be conserved at -20°C or -80°C . The protein is typically supplied in a Tris-based buffer with 50% glycerol, which has been optimized for this specific protein.

Important handling notes:

• Repeated freezing and thawing is not recommended as it may lead to protein denaturation and loss of activity

• Working aliquots can be stored at 4°C for up to one week

• For experimental use, it's advisable to prepare small aliquots to avoid multiple freeze-thaw cycles

What molecular mechanisms underlie MdtI function in spermidine transport?

The molecular mechanisms of MdtI-mediated spermidine transport involve specific amino acid residues that are critical for substrate recognition and translocation. Based on studies of homologous proteins in E. coli, several key residues have been identified in the MdtI protein that are essential for its function:

• Acidic residues including Glu5, Glu19, and Asp60 are critical for spermidine transport

• Aromatic residues such as Trp68 and Trp81 appear to be involved in substrate binding or channel formation

• These residues likely form a charge relay system that facilitates the movement of the positively charged spermidine molecule across the membrane

The transport process appears to be energy-dependent, possibly utilizing proton motive force to drive spermidine export. The level of mdtJI mRNA has been shown to increase in response to elevated spermidine levels, suggesting a regulatory feedback mechanism that enhances export capacity when intracellular concentrations become high .

How is MdtI expression regulated under different environmental conditions?

MdtI expression is regulated in response to various environmental conditions, particularly those that affect intracellular polyamine concentrations. Research indicates that:

• Spermidine levels directly influence mdtJI expression - elevated intracellular spermidine concentrations lead to increased mdtJI mRNA levels

• Stress conditions that alter polyamine metabolism may indirectly affect MdtI expression

• The functional categories of genes related to MdtI and other Group 8 Citrobacter koseri-specific core genes are enriched in:

  • Transport and metabolism functions

  • Signal transduction systems responsible for sensing environmental cues

  • Membrane components and cellular processes

These regulatory mechanisms likely allow bacterial cells to adapt to changing environmental conditions by modulating polyamine export capacity through the MdtJI system.

What is the relationship between MdtI and bacterial virulence in Citrobacter koseri?

While MdtI itself has not been directly implicated as a virulence factor, it exists within the context of Citrobacter koseri's pathogenicity mechanisms. C. koseri is known for causing severe central nervous system infections, particularly in neonates, with high mortality and morbidity rates . Several key observations connect polyamine transport systems with virulence:

• Polyamine homeostasis is essential for bacterial growth and adaptation to host environments

• C. koseri possesses several virulence-associated genetic elements:

  • High-pathogenicity island (HPI) cluster

  • Aerobactin biosynthetic gene cluster

  • Methionine-salvage related gene cluster

  • Various ABC transporters

• Animal experiments demonstrated that loss of the HPI cluster significantly decreased C. koseri virulence in mice and rat models:

  • In 18-day-old mice infected with HPI-deficient mutants, bacterial levels in cerebrospinal fluid were significantly lower than in wild-type infections

  • In 2-day-old rats, HPI mutants showed markedly decreased colonization in both blood and CSF

While these studies don't directly examine MdtI's role in virulence, they suggest that specialized transport systems like MdtJI may contribute to C. koseri's ability to establish infection and cause disease, particularly by helping bacteria maintain cellular homeostasis under stress conditions encountered during infection.

How does MdtI from C. koseri compare with homologs in other bacterial species?

Comparative genomic analysis reveals that MdtI belongs to a conserved family of small multidrug resistance transporters found across many bacterial species, with notable variations:

• Phylogenetic analysis places C. koseri in Group 8 of the Citrobacter genus, with distinct genetic characteristics compared to other groups

• Core gene differences between C. koseri (Group 8) and other Citrobacter species are primarily related to:

  • Transport and metabolism of carbohydrates

  • Translation and ribosomal structure

  • Inorganic ion transport and metabolism

• Functional comparison with E. coli MdtI:

  • Both proteins show similar roles in spermidine export

  • Key functional residues appear to be conserved between species

  • Both function as part of a complex with MdtJ

• Analysis of the pan-genome identified 20,114 gene families across 129 Citrobacter genomes, with 1,450 constituting the core genome

This comparative analysis suggests that while the basic function of MdtI is conserved across species, variations in sequence and regulation may contribute to differences in polyamine handling between bacterial species, potentially influencing their adaptation to different ecological niches.

What are the optimal methods for expressing and purifying recombinant MdtI protein?

For successful expression and purification of recombinant Citrobacter koseri MdtI protein, researchers should consider the following methodological approach:

Expression System Selection:

• E. coli expression systems (BL21(DE3) or similar strains) are commonly used for membrane protein expression

• Consider using vectors with tunable promoters to control expression levels, as membrane proteins can be toxic when overexpressed

Optimization Protocol:

• Expression temperature: Lower temperatures (16-20°C) often improve membrane protein folding

• Induction conditions: Use lower IPTG concentrations (0.1-0.5 mM) for gentler induction

• Addition of specific detergents to the culture medium may improve membrane protein expression

Purification Strategy:

• Membrane fraction isolation using ultracentrifugation

• Solubilization with appropriate detergents (DDM, LDAO, or similar mild detergents)

• Affinity chromatography using histidine or other fusion tags

• Size exclusion chromatography for final purification step

Storage Considerations:

• Store in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term storage

• Avoid repeated freeze-thaw cycles

• Maintain small working aliquots at 4°C for up to one week

How can researchers effectively measure MdtI-mediated spermidine export activity?

Several experimental approaches can be employed to measure MdtI-mediated spermidine export activity:

Radioactive Transport Assays:

• Preload cells with [14C]spermidine

• Measure the rate of [14C]spermidine excretion from cells expressing MdtI/MdtJI versus control cells

• Collect time-point samples and quantify radioactivity using liquid scintillation counting

Cell Viability Assays Under Spermidine Toxicity:

• Culture cells deficient in spermidine acetyltransferase (which prevents spermidine metabolism)

• Compare growth/viability of cells with and without MdtI/MdtJI expression when exposed to high spermidine concentrations (2-12 mM)

• Quantify cell viability using standard methods like colony counting or growth curve analysis

Intracellular Polyamine Quantification:

• Grow cells with or without MdtI/MdtJI expression in the presence of exogenous spermidine

• Extract cellular polyamines using perchloric acid extraction

• Quantify spermidine levels using HPLC with post-column derivatization or LC-MS/MS methods

• Compare intracellular spermidine accumulation between experimental groups

These methodologies can be adapted to study both wild-type MdtI and mutant variants to assess the impact of specific amino acid substitutions on transport activity.

What experimental models are suitable for studying MdtI function in virulence?

Several experimental models can be employed to study the potential role of MdtI in bacterial virulence:

In Vitro Cellular Models:

• Human or animal cell lines relevant to C. koseri infection sites (e.g., brain microvascular endothelial cells, astrocytes, or macrophages)

• Measure bacterial invasion, intracellular survival, and cytotoxicity of wild-type versus mdtI mutant strains

• Assess the impact of polyamine availability on infection dynamics

Animal Models:

• Neonatal rat model: 2-day-old SD rats can be used to study C. koseri meningitis and brain abscess formation

  • Inoculate with wild-type or mdtI-deficient C. koseri

  • Collect blood and cerebrospinal fluid (CSF) samples for bacterial quantification

  • Perform histopathological analysis of brain tissue

• Mouse model: 18-day-old BALB/c mice provide an alternative model system

  • Administer approximately 1×107 CFUs of bacteria

  • Monitor for signs of infection and disease progression

  • Quantify bacterial loads in blood and CSF at defined time points

Genetic Approaches:

• Gene knockout/complementation: Create mdtI deletion mutants and complemented strains

• Conditional expression systems to control mdtI expression during infection

• Reporter constructs to monitor mdtI expression in different host environments

These models can provide valuable insights into the potential contribution of MdtI to C. koseri virulence and pathogenesis in both in vitro and in vivo settings.

What techniques can be used to study MdtI-MdtJ protein-protein interactions?

Understanding the interaction between MdtI and MdtJ proteins is critical for elucidating the functional mechanism of the spermidine export complex. Several techniques can be employed:

Co-immunoprecipitation (Co-IP):

• Express tagged versions of MdtI and MdtJ (e.g., His-tag, FLAG-tag)

• Use antibodies against one tag to pull down the protein complex

• Detect the interacting partner using western blotting

Förster Resonance Energy Transfer (FRET):

• Create fusion proteins with appropriate fluorophore pairs (e.g., CFP-MdtI and YFP-MdtJ)

• Measure energy transfer as an indicator of protein proximity

• This technique is particularly valuable for membrane proteins as it can be performed in intact cells

Bacterial Two-Hybrid System:

• Adapt bacterial two-hybrid systems for membrane protein interaction studies

• Fusion constructs with T18 and T25 fragments of adenylate cyclase

• Interaction reconstitutes cyclase activity, activating reporter gene expression

Cross-linking Studies:

• Use chemical cross-linkers with different spacer arm lengths

• Identify cross-linked products by mass spectrometry

• This approach can identify specific residues involved in the interaction

Molecular Dynamics Simulations:

• Construct computational models of the MdtI-MdtJ complex

• Simulate protein dynamics to identify stable interaction interfaces

• Generate hypotheses that can be tested experimentally with site-directed mutagenesis

These complementary approaches can provide a comprehensive understanding of how MdtI and MdtJ interact to form a functional spermidine export complex.

What is the clinical relevance of understanding MdtI function in C. koseri infections?

Understanding the function of MdtI in C. koseri has significant clinical implications due to the serious nature of infections caused by this organism:

• C. koseri is a known cause of severe central nervous system infections, particularly in neonates:

  • Fatal in 30% of cases

  • Permanently debilitating in up to 80% of those affected

• C. koseri can cause rare but serious musculoskeletal infections:

  • Only 14 cases have been reported in the literature

  • Five were associated with operative procedures

  • Five involved septic joints

• Understanding transport mechanisms like MdtI may provide insights into:

  • Bacterial survival within host environments

  • Stress response mechanisms during infection

  • Potential targets for novel antimicrobial strategies

• C. koseri possesses fewer antibiotic resistance genes compared to other Citrobacter species, potentially explaining its greater susceptibility to certain antibiotics

By elucidating the role of MdtI in polyamine homeostasis and potentially in virulence, researchers may identify new approaches to combat C. koseri infections, particularly in vulnerable populations like neonates.

How do mutations in key amino acid residues affect MdtI function and bacterial fitness?

Specific amino acid residues in MdtI play critical roles in the protein's function, and mutations can significantly impact spermidine export activity and bacterial fitness:

Key Functional Residues:
Based on studies of homologous proteins in E. coli, several critical residues have been identified in MdtI:

• Glu5, Glu19, and Asp60: Likely involved in substrate recognition or translocation

• Trp68 and Trp81: May contribute to substrate binding or channel formation

Effects of Mutations:

• Mutation of these key residues can lead to:

  • Reduced spermidine export efficiency

  • Increased sensitivity to spermidine toxicity

  • Altered substrate specificity

• Impact on bacterial fitness:

  • Decreased growth rates under high spermidine conditions

  • Reduced ability to adapt to changing environments

  • Potential attenuation of virulence in infection models

Experimental Evidence:
Studies in E. coli have shown that cells expressing mutant forms of MdtI with substitutions at key residues demonstrate significantly reduced ability to excrete spermidine and recover from spermidine toxicity compared to those expressing wild-type MdtI .

This understanding of structure-function relationships in MdtI could potentially be exploited for the development of inhibitors targeting this transport system as a novel approach to combat bacterial infections.

What are the future research directions for MdtI in C. koseri?

Future research on MdtI in Citrobacter koseri should address several important knowledge gaps and potentially explore therapeutic applications:

• Structural studies:

  • Determine high-resolution structure of the MdtI/MdtJ complex

  • Characterize the spermidine binding site and transport channel

  • Elucidate the molecular mechanism of substrate translocation

• Regulation studies:

  • Identify transcriptional regulators controlling mdtI expression

  • Characterize signaling pathways that respond to polyamine stress

  • Explore epigenetic regulation of mdtI under different growth conditions

• Host-pathogen interaction:

  • Investigate the role of MdtI in C. koseri survival within host cells

  • Determine how polyamine transport affects bacterial adaptation to host defense mechanisms

  • Explore the relationship between MdtI function and C. koseri neurotropism

• Therapeutic targeting:

  • Design small molecule inhibitors of MdtI function

  • Evaluate polyamine transport inhibition as an antivirulence strategy

  • Develop combination therapies targeting multiple transport systems

• Comparative studies:

  • Expand analysis across different Citrobacter species and clinical isolates

  • Investigate how variations in MdtI sequence correlate with bacterial pathogenicity

  • Examine coevolution of polyamine transport systems and antibiotic resistance mechanisms