Recombinant Citrobacter koseri Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Description

Functional Insights

MdtJ functions as part of the MdtJI complex, a small multidrug resistance (SMR) family exporter critical for spermidine homeostasis:

  • Spermidine Excretion: MdtJI alleviates intracellular spermidine toxicity by exporting excess polyamines . In E. coli, deletion of mdtJ disrupts this process, though C. koseri studies show no significant impact on biofilm formation or spermidine levels in knockout strains .

  • Key Residues: Tyr⁴, Trp⁵, Glu¹⁵, and Glu⁸² in MdtJ are essential for transport activity .

Recombinant Expression and Applications

  • Production System: Expressed in E. coli for high yield and solubility .

  • Research Use:

    • Study polyamine transport mechanisms in Gram-negative bacteria.

    • Investigate antibiotic susceptibility links (C. koseri has fewer resistance genes than other Citrobacter spp., making it a model for intrinsic drug sensitivity) .

Comparative Genomic Analysis

  • Pathogenicity: C. koseri’s high-pathogenicity island (HPI) cluster enhances virulence, but MdtJ is not directly linked to this system .

  • Antibiotic Susceptibility: Reduced resistance genes in C. koseri correlate with clinical susceptibility to cephalosporins and quinolones .

Future Directions

  • Mechanistic Studies: Resolve MdtJI’s 3D structure to elucidate spermidine transport dynamics.

  • Therapeutic Potential: Explore polyamine transport inhibition as an antimicrobial strategy against Citrobacter infections .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
mdtJ; CKO_01606; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Target Names
mdtJ
Target Protein Sequence
MFYWILLALAIAAEITGTLSMKWASVSNGNTGFILMLVMITLSYIFLSFAVKKIALGVAY ALWEGIGILFITLFSVLLFDEALSAMKIAGLVTLVFGIALIKSGTRKPVNAAKEATHAAV
Uniprot No.

Target Background

Function
Catalyzes the excretion of spermidine.
Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the MdtJI complex and what is its primary function?

Basic Research Question

The MdtJI complex is a protein complex consisting of MdtJ and MdtI, which together function as a spermidine exporter in bacterial cells. Both proteins belong to the small multidrug resistance (SMR) family of drug exporters. The primary function of the MdtJI complex is to catalyze the excretion of spermidine from bacterial cells, which is essential for maintaining polyamine homeostasis .

Experimental evidence demonstrates that the MdtJI complex reduces intracellular spermidine content in cells cultured in high spermidine concentrations (2 mM). Cells transformed with pUCmdtJI or pMWmdtJI showed decreased spermidine content and enhanced excretion of spermidine from cells, confirming that the complex functions as a spermidine exporter .

Why are both MdtJ and MdtI necessary for spermidine export function?

Advanced Research Question

Both MdtJ and MdtI proteins are essential components of the functional spermidine export complex. Research has demonstrated that neither protein alone can effectively recover cells from spermidine toxicity; both genes must be expressed together to form a functional exporter .

This cooperative functionality likely stems from the structural arrangement of the complex, where both proteins contribute specific amino acid residues that are critical for spermidine recognition and transport. Specifically, Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82 in MdtJ and Glu5, Glu19, Asp60, Trp68, and Trp81 in MdtI have been identified as involved in the excretion activity of the MdtJI complex . These residues likely form a transport channel or binding site that facilitates spermidine export.

What experimental approaches can be used to study MdtJ function?

Basic Research Question

Several methodological approaches can be employed to study MdtJ function:

  • Gene Knockout Studies: Construct ΔmdtJ mutant strains using techniques such as λRed Recombinase System, where mdtJ gene fragments are replaced with a selectable marker like chloramphenicol acetyltransferase cassette .

  • Complementation Assays: Transform cells lacking functional MdtJ with plasmids expressing the wild-type protein (e.g., pUCmdtJI or pMWmdtJI) and assess recovery of function .

  • Spermidine Toxicity Assays: Measure cell viability and growth in the presence of high spermidine concentrations, with and without functional MdtJ .

  • Polyamine Content Analysis: Quantify intracellular spermidine levels using methods such as HPLC to determine export function .

  • Radiolabeled Spermidine Export Assays: Use [14C]spermidine to track the export of spermidine from cells, measuring both the decrease in cellular content and increase in extracellular spermidine .

How can site-directed mutagenesis be used to identify key amino acid residues in MdtJ?

Advanced Research Question

Site-directed mutagenesis is a powerful approach to identify functionally important amino acid residues in MdtJ. The methodology involves:

  • Target Selection: Based on sequence conservation, structural predictions, or homology models, select candidate residues for mutation. For MdtJ, focus on charged or aromatic residues like Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82, which have been identified as functionally important .

  • Primer Design: Design primers containing the desired nucleotide substitutions that will change the targeted amino acid.

  • Mutagenesis Procedure: Use PCR-based site-directed mutagenesis techniques to introduce mutations.

  • Verification: Sequence the mutated constructs to confirm the presence of desired mutations.

  • Functional Assessment: Transform the mutant constructs into cells lacking endogenous MdtJ and assess:

    • Spermidine export capability through radioactive assays or HPLC

    • Cell growth recovery in high spermidine conditions

    • Protein expression levels through Western blotting

  • Comparative Analysis: Create a data table comparing wild-type and mutant activities as shown below:

MutationSpermidine Export (% of wild-type)Growth Recovery in 2 mM SpermidineProtein Expression Level
Wild-type100%+++Normal
Y4A(determined experimentally)(determined experimentally)(determined experimentally)
W5A(determined experimentally)(determined experimentally)(determined experimentally)
E15A(determined experimentally)(determined experimentally)(determined experimentally)

This methodical approach allows for precise determination of each residue's contribution to MdtJ function.

How is mdtJI expression regulated in response to spermidine?

Advanced Research Question

The expression of mdtJI is upregulated in response to spermidine exposure, indicating a regulatory mechanism that responds to polyamine levels. Research has shown that the level of mdtJI mRNA increases when cells are exposed to spermidine .

To investigate this regulatory mechanism experimentally:

  • mRNA Quantification: Use RT-qPCR to measure mdtJI transcript levels under various spermidine concentrations and exposure times.

  • Promoter Analysis: Clone the putative promoter region of mdtJI into a reporter vector (e.g., containing GFP or luciferase) to monitor promoter activity under different conditions.

  • Transcription Factor Identification: Perform DNA-protein interaction assays such as electrophoretic mobility shift assays (EMSA) or chromatin immunoprecipitation (ChIP) to identify transcription factors that bind to the mdtJI promoter.

  • Mutational Analysis: Create mutations in potential regulatory elements within the promoter region to identify critical sequences.

  • Global Regulators: Investigate whether known polyamine-responsive transcription factors interact with the mdtJI promoter.

Understanding this regulation is crucial for comprehending how bacterial cells maintain polyamine homeostasis through coordinated control of synthesis, degradation, uptake, and export pathways.

What methods can be used to study the relationship between MdtJI and biofilm formation?

Basic Research Question

To investigate the relationship between MdtJI and biofilm formation, researchers can employ several methodological approaches:

  • Mutant Construction: Generate mdtJ and/or mdtI deletion mutants using techniques like λRed recombination .

  • Biofilm Quantification Assays:

    • Crystal violet staining of adherent biofilms in microtiter plates

    • Confocal laser scanning microscopy with fluorescently labeled cells

    • Flow cell systems for continuous culture biofilms

  • Spermidine Supplementation Experiments: Assess biofilm formation with varying concentrations of exogenous spermidine in both wild-type and mdtJI mutant strains .

  • Intracellular Polyamine Measurement: Quantify intracellular spermidine levels in biofilm and planktonic cells using HPLC or LC-MS techniques .

  • Gene Expression Analysis: Use RNA-seq or microarrays to identify genes differentially expressed in wild-type versus mdtJI mutants during biofilm formation.

A published study found no significant difference in biofilm formation between wild-type and ΔmdtJ strains in E. coli, even when grown in medium supplemented with spermidine . This suggests that in some organisms or under certain conditions, MdtJI may not directly influence biofilm formation despite its role in spermidine export.

How conserved is the MdtJI complex across different bacterial species?

Advanced Research Question

The conservation of the MdtJI complex across bacterial species can be methodically assessed through comparative genomic approaches:

  • Sequence Analysis:

    • Perform BLAST searches using C. koseri MdtJ/MdtI sequences as queries against bacterial genome databases

    • Conduct multiple sequence alignments to identify conserved regions and residues

    • Calculate sequence identity and similarity percentages across species

  • Genomic Context Analysis:

    • Examine the genomic neighborhood of mdtJI genes across species to identify conserved synteny

    • Determine whether the genes are consistently co-localized or occasionally separated

  • Phylogenetic Analysis:

    • Construct phylogenetic trees based on MdtJ/MdtI sequences

    • Compare protein phylogeny with species phylogeny to detect horizontal gene transfer events

Comparative genomic analysis of Citrobacter species has been conducted, including whole genome sequencing of 129 Citrobacter genomes . These analyses have revealed that the genus can be classified into 11 distinct groups based on core genome single-nucleotide polymorphisms (SNPs), with all C. koseri strains clustering into a single group .

When examining transporter systems and their conservation, researchers have identified group-specific genes that could contribute to pathogenicity and antibiotic susceptibility differences between species such as C. koseri and C. freundii . Similar approaches could be applied specifically to the MdtJI complex to understand its evolution and conservation.

What bioinformatic tools and databases are useful for studying MdtJ structure and function?

Basic Research Question

Several bioinformatic tools and databases are valuable for investigating MdtJ structure and function:

  • Sequence Databases:

    • UniProt (A8AGX4 for C. koseri MdtI)

    • NCBI Protein and Nucleotide databases

    • Specialized transporter databases like TCDB (Transporter Classification Database)

  • Structure Prediction Tools:

    • AlphaFold or RoseTTAFold for protein structure prediction

    • SWISS-MODEL for homology modeling

    • TMHMM or TOPCONS for transmembrane domain prediction

    • ConSurf for mapping conservation onto structural models

  • Functional Analysis Tools:

    • InterProScan for domain and motif identification

    • MacSyFinder and TXSScan for macromolecular system identification

    • SecReT6 for Type VI secretion system prediction (methodology example)

  • Genomic Context Analysis:

    • IslandViewer for genomic island detection

    • CodonW for codon usage and GC content analysis

  • Comparative Analysis Resources:

    • Large-scale BLAST score ratio (LS-BSR) tool for comparison against databases like the Virulence Factors Database and the Comprehensive Antibiotic Resistance Database

These tools can be used in a coordinated workflow to gain comprehensive insights into MdtJ structure, function, and evolutionary relationships.

How might understanding MdtJ function contribute to antibacterial strategies?

Advanced Research Question

Understanding MdtJ function could contribute to novel antibacterial strategies through several mechanism-based approaches:

  • Inhibitor Development: Design inhibitors that specifically target the MdtJI complex, disrupting spermidine export and potentially leading to toxic accumulation of polyamines in bacterial cells. Structural information about the critical residues (Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82 in MdtJ) could guide rational drug design.

  • Polyamine Metabolism Targeting: Combine MdtJI inhibition with approaches that increase intracellular spermidine synthesis or prevent spermidine degradation, potentially creating a synergistic effect that leads to toxic polyamine accumulation.

  • Virulence Modulation: In pathogenic bacteria where polyamine homeostasis affects virulence, MdtJI inhibition could potentially attenuate pathogenicity without directly killing bacteria, which might reduce selective pressure for resistance development.

  • Species-Specific Targeting: Comparative genomic analysis reveals differences in transporter systems between species . These differences could be exploited to develop species-specific antibacterial strategies, particularly for pathogens like C. koseri which are known to cause meningitis and brain abscesses in neonates and immunocompromised individuals .

  • Combination Therapies: Research indicates that C. freundii is less susceptible than C. koseri to several antibiotics . Understanding the mechanisms behind these differences, potentially including differences in export systems like MdtJI, could lead to more effective combination therapies.

Methodological approaches to explore these possibilities would involve screening compound libraries against recombinant MdtJI, structure-based drug design, and in vivo testing of candidate inhibitors.

What experimental protocols are recommended for protein-protein interaction studies of MdtJ and MdtI?

Basic Research Question

To investigate protein-protein interactions between MdtJ and MdtI, researchers can employ the following methodological approaches:

  • Co-immunoprecipitation (Co-IP):

    • Express tagged versions of MdtJ and MdtI (His-tag, FLAG-tag, etc.)

    • Lyse cells and immunoprecipitate with antibodies against one tag

    • Detect the co-precipitated partner protein by Western blotting

    • Include appropriate controls (e.g., individual protein expressions, non-specific antibodies)

  • Bacterial Two-Hybrid (B2H) or Yeast Two-Hybrid (Y2H) Assays:

    • Clone mdtJ and mdtI into appropriate vectors

    • Transform into reporter strains

    • Measure reporter gene activation as an indicator of protein interaction

    • Include positive and negative control interactions

  • Förster Resonance Energy Transfer (FRET):

    • Create fluorescent protein fusions (e.g., MdtJ-CFP and MdtI-YFP)

    • Express in bacterial cells

    • Measure energy transfer using fluorescence microscopy or flow cytometry

    • Calculate FRET efficiency to quantify interaction strength

  • Surface Plasmon Resonance (SPR):

    • Purify recombinant MdtJ and MdtI proteins

    • Immobilize one protein on a sensor chip

    • Flow the partner protein over the chip at varying concentrations

    • Measure binding kinetics (association and dissociation rates)

  • Cross-linking Mass Spectrometry:

    • Express and purify the MdtJI complex

    • Apply chemical cross-linkers to stabilize protein-protein interactions

    • Digest the cross-linked complex

    • Identify cross-linked peptides by mass spectrometry

    • Map interaction interfaces

These approaches can be used in combination to provide complementary evidence for the interaction between MdtJ and MdtI, as well as to identify specific residues involved in complex formation.

How can researchers overcome challenges in the recombinant expression of membrane proteins like MdtJ?

Advanced Research Question

Membrane proteins like MdtJ present unique challenges for recombinant expression. Here are methodological approaches to overcome these challenges:

  • Expression System Selection:

    • E. coli C41(DE3) or C43(DE3) strains specifically developed for membrane protein expression

    • Cell-free expression systems that can incorporate detergents or lipids during translation

    • Yeast systems (e.g., Pichia pastoris) for eukaryotic-like membrane protein folding

  • Expression Construct Optimization:

    • Test multiple fusion tags (His, MBP, SUMO) at both N- and C-termini

    • Optimize codon usage for the expression host

    • Consider truncated constructs that retain functional domains

  • Induction Conditions:

    • Lower temperatures (16-25°C) to slow folding and reduce inclusion body formation

    • Reduced inducer concentrations for lower expression rates

    • Extended expression times with mild induction

  • Solubilization and Purification:

    • Screen multiple detergents (DDM, LDAO, CHAPS) for effective solubilization

    • Use a systematic detergent screening approach with small-scale expressions

    • Consider nanodiscs or styrene maleic acid copolymer lipid particles (SMALPs) for native-like membrane environments

    • Implement two-step purification (e.g., affinity chromatography followed by size exclusion)

  • Functional Validation:

    • Develop assays to verify that the purified protein retains its native structure and function

    • For MdtJ/MdtI, reconstitute into liposomes and measure spermidine transport activity

  • Storage Conditions:

    • Optimize buffer conditions (pH, salt concentration, additives)

    • Test stability in different detergents or membrane mimetics

    • Investigate cryoprotectants for freeze-thaw stability

The recombinant MdtI protein from C. koseri is commercially available (50 μg), stored in a Tris-based buffer with 50% glycerol, and recommended to be stored at -20°C or -80°C for extended storage . Similar approaches could be applied to MdtJ expression and purification.

What are the common pitfalls in MdtJ functional assays and how can they be avoided?

Basic Research Question

When conducting functional assays for MdtJ, researchers should be aware of these common pitfalls and corresponding solutions:

  • Inadequate Gene Knockout Verification:

    • Pitfall: Incomplete deletion or unexpected chromosomal rearrangements

    • Solution: Verify knockout strains using PCR amplification and sequencing . Design primers to amplify regions extending beyond the targeted deletion to ensure complete removal.

  • Spermidine Toxicity Variability:

    • Pitfall: Inconsistent results in toxicity assays due to strain-specific tolerance

    • Solution: Use strains deficient in spermidine acetyltransferase (which metabolizes spermidine) to enhance sensitivity to spermidine accumulation. Include appropriate positive and negative controls.

  • Polyamine Content Measurement Challenges:

    • Pitfall: Cross-reactivity or poor resolution in polyamine analysis

    • Solution: Employ HPLC or LC-MS techniques with appropriate standards for accurate quantification. Include internal standards and validate the linearity of detection.

  • Plasmid Stability Issues:

    • Pitfall: Loss of complementation plasmids during experiments without selection

    • Solution: Maintain selection pressure with appropriate antibiotics throughout the experiment . Consider using stable integration vectors for long-term studies.

  • Endogenous Expression Interference:

    • Pitfall: Background activity from host proteins with similar functions

    • Solution: Use multiple strain backgrounds to verify results. Consider heterologous expression in systems without similar transport proteins.

  • Inadequate Controls in Biofilm Assays:

    • Pitfall: Biofilm formation variability due to environmental factors

    • Solution: Include relevant control strains with known biofilm phenotypes. Standardize growth conditions rigorously, including medium composition, temperature, and vessel surface properties .

By anticipating these challenges and implementing the suggested solutions, researchers can increase the reliability and reproducibility of their MdtJ functional studies.

How should researchers analyze and interpret contradictory data regarding MdtJ function?

Advanced Research Question

When faced with contradictory data regarding MdtJ function, researchers should employ a systematic approach to analysis and interpretation:

  • Methodological Examination:

    • Compare experimental protocols in detail to identify subtle differences

    • Assess reagent quality, particularly recombinant proteins or antibodies

    • Verify genetic constructs through sequencing

    • Examine cell strain backgrounds for genetic differences

  • Statistical Reevaluation:

    • Increase sample sizes to improve statistical power

    • Apply appropriate statistical tests based on data distribution

    • Consider biological versus technical replicates in the analysis

    • Evaluate effect sizes rather than just statistical significance

  • Contextual Factors Assessment:

    • Consider environmental conditions that might affect results (pH, temperature, media composition)

    • Evaluate growth phase or cell state influences

    • Examine possible compensation by redundant systems

  • Structured Data Organization:

    • Create comprehensive data tables comparing contradictory results

    • Include all relevant experimental parameters

    • Highlight similarities and differences in conditions

StudyExperimental SystemMdtJ Effect on Spermidine ExportExperimental ConditionsKey Controls
Study AE. coli CAG2242Significant increase2 mM spermidine, 37°CVector only
Study BE. coli SH1851No significant effectVarious spermidine conc., 37°CWild-type strain
  • Mechanistic Hypothesis Development:

    • Formulate testable hypotheses that could explain the contradictions

    • Design critical experiments specifically to address these contradictions

    • Consider whether the contradictions reflect genuine biological complexity

For example, in the case of MdtJ, contradictory results regarding its influence on biofilm formation versus its established role in spermidine export could be reconciled by examining strain-specific differences, growth conditions, or the possibility that spermidine export might affect biofilm formation only under specific environmental conditions.

What quality control measures should be implemented when working with recombinant MdtJ protein?

Basic Research Question

To ensure high-quality results when working with recombinant MdtJ protein, researchers should implement these quality control measures:

  • Expression Verification:

    • SDS-PAGE analysis to confirm protein size

    • Western blotting with tag-specific or MdtJ-specific antibodies

    • Mass spectrometry to verify protein identity

  • Purity Assessment:

    • Densitometric analysis of stained gels (aim for >90% purity)

    • Size-exclusion chromatography to detect aggregates or contaminants

    • Dynamic light scattering to assess homogeneity

  • Functional Verification:

    • Binding assays with known ligands (e.g., spermidine)

    • Reconstitution into liposomes for transport assays

    • Circular dichroism to verify secondary structure composition

  • Storage Stability Monitoring:

    • Aliquot proteins to avoid freeze-thaw cycles

    • Verify activity after storage periods

    • Monitor for degradation by SDS-PAGE

    • For MdtJ specifically, storage recommendations include -20°C for short-term and -80°C for long-term storage in a Tris-based buffer with 50% glycerol

  • Batch Consistency Checks:

    • Maintain detailed records of each preparation

    • Compare key parameters between batches (yield, purity, activity)

    • Include positive controls from previous successful batches in new experiments

  • Detergent Critical Micelle Concentration (CMC) Monitoring:

    • Ensure detergent concentration remains above CMC during all procedures

    • Verify detergent removal when reconstituting into lipid environments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.