Recombinant Citrobacter koseri Thiol:disulfide interchange protein DsbD (dsbD)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

DsbD is a membrane-anchored oxidoreductase that transfers reducing equivalents from cytoplasmic thioredoxin to periplasmic substrates, ensuring proper disulfide bond formation in secreted proteins . In Citrobacter koseri, a Gram-negative pathogen associated with neonatal meningitis and opportunistic infections, DsbD supports virulence by facilitating the folding of toxins, adhesins, and secretion systems .

Table 2: Biochemical Properties

ParameterDetails
Host SystemE. coli, yeast, or mammalian cells
Purity≥85% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose, pH 8.0
ReconstitutionDeionized water + 5–50% glycerol for stability

Functional Mechanisms

DsbD operates via a three-domain architecture:

  • N-terminal domain: Receives electrons from cytoplasmic thioredoxin.

  • Transmembrane domain: Transfers electrons across the inner membrane.

  • C-terminal domain: Delivers electrons to periplasmic substrates like DsbC or cytochromes .

This electron shuttle ensures redox balance in the periplasm, enabling:

  • Correction of non-native disulfide bonds in virulence factors .

  • Maturation of c-type cytochromes for electron transport .

  • Protection against oxidative stress during host infection .

Research Applications

Recombinant C. koseri DsbD is utilized in:

  • Pathogenicity studies: Investigating its role in bacterial colonization and immune evasion .

  • Antibiotic resistance research: Analyzing links between redox homeostasis and carbapenem resistance .

  • Structural biology: Resolving conformational changes during electron transfer .

Key Research Findings

  • Genomic Context: C. koseri DsbD is part of a conserved scs operon linked to copper resistance and oxidative stress tolerance .

  • Virulence Association: Knockout mutants of DsbD homologs in Salmonella and E. coli show attenuated virulence, underscoring its therapeutic potential .

  • Clinical Relevance: C. koseri strains lacking redox homeostasis genes exhibit reduced survival in host blood and cerebrospinal fluid .

Future Directions

Ongoing studies aim to:

  • Characterize DsbD’s interaction with virulence-associated transporters .

  • Develop inhibitors targeting its redox activity to combat multidrug-resistant C. koseri .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
dsbD; CKO_03700; Thiol:disulfide interchange protein DsbD; Protein-disulfide reductase; Disulfide reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-569
Protein Length
Full Length of Mature Protein
Species
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Target Names
dsbD
Target Protein Sequence
GLFDAPGRSQFVPADQAFSFDFQQNQHDLNLSWQVKDGYYLYRKQISITPSQAEIAEVRL PAGVWHEDEFYGKSEIYRKRLNIPLIVNQAASGATLTVTYQGCADAGFCYPPETKTVPLS EVSASTVAKSTPSPVAAQTEETPQPAARLPFSALWALLIGIGIAFTPCVLPMYPLISGIV LGGKQRLSTGRALLLTFIYVQGMALTYTALGLVVAAAGLQFQAALQHPYVLIGLALVFTL LALSMFGLFTLQLPSSLQTRLTLMSNRQQGGSPGGVFVMGAIAGLICSPCTTAPLSAILL YIAQSGNMWLGGGTLYLYALGMGLPLILITVFGNRLLPKSGPWMEHVKTAFGFVILALPV FLLERVIGDEWGLRLWSLLGVAFFGWAFITSLHARRSGMRIVQIILLAAALVSVRPLQDW AFGATTAQTQAHLNFKPITTVDALNQALAEAKGKPIMLDLYADWCVACKEFEKYTFSDPQ VQQTLGDTVLLQANVTANNAQDVALLRHLNVLGLPTILFFDAQGHEHPNARVTGFMDATT FSAHLRDRQP
Uniprot No.

Target Background

Function

Facilitates the formation of correct disulfide bonds in some periplasmic proteins and the assembly of periplasmic c-type cytochromes. It functions by transferring electrons from cytoplasmic thioredoxin to the periplasm. This transfer involves a cascade of disulfide bond formation and reduction steps.

Database Links
Protein Families
Thioredoxin family, DsbD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the dsbD gene in Citrobacter koseri?

The dsbD gene in C. koseri is notably found within a specific genetic context. In carbapenem-resistant isolates, it has been identified as part of the ISKpn19-blaNDM-1-ble-tnpF-dsbD-cutA-ISKpn19 cassette array . This genomic arrangement provides important context for understanding the potential association between DsbD and antimicrobial resistance mechanisms. When studying the dsbD gene:

  • Consider the complete genetic context rather than isolating the gene

  • Assess the conservation of this genomic structure across different C. koseri isolates

  • Evaluate potential co-transcription patterns with adjacent genes

  • Investigate the possibility of horizontal gene transfer events that may have incorporated dsbD into this cassette

How does DsbD contribute to the pathogenicity of Citrobacter koseri?

C. koseri is an opportunistic pathogen capable of causing serious infections, particularly meningitis and brain abscesses in neonates and immunocompromised individuals . While specific research on DsbD's contribution to pathogenicity in C. koseri is limited, we can analyze its role based on established bacterial pathogenicity mechanisms:

  • DsbD likely participates in maintaining proper protein folding in the bacterial periplasm

  • As a thiol:disulfide interchange protein, it may be crucial for the structural integrity of secreted virulence factors

  • It could be linked to stress response mechanisms that help the bacteria survive hostile host environments

  • Its location in genetic islands associated with virulence genes suggests potential co-regulation with pathogenicity factors

Research indicates that C. koseri's unique pathogenicity is partly attributed to specific genetic elements like the high-pathogenicity island (HPI) cluster, which significantly enhances its ability to replicate in brain tissue and cause CNS infections . Investigating potential interactions between DsbD and proteins encoded by the HPI cluster could reveal important virulence mechanisms.

What are the optimal protocols for cloning and expressing recombinant C. koseri DsbD?

When working with recombinant C. koseri DsbD, consider the following protocol recommendations:

Cloning Strategy:

  • Amplify the dsbD gene using high-fidelity DNA polymerase with primers designed to include appropriate restriction sites

  • Include a C-terminal or N-terminal His-tag for purification, considering that N-terminal tags may interfere with the protein's signal sequence

  • Consider using a pET expression system with T7 promoter for high-yield expression

  • Optimize codon usage for E. coli if expression levels are low

Expression Conditions:

  • Use E. coli BL21(DE3) or C41(DE3) for membrane/periplasmic protein expression

  • Induce with 0.1-0.5 mM IPTG at reduced temperatures (16-25°C) to enhance proper folding

  • Consider adding 0.2-0.5% glucose to the medium to reduce basal expression

  • For membrane proteins, supplement with 1% glycerol to stabilize membrane fractions

Since DsbD is a thiol:disulfide interchange protein, particular attention should be paid to maintaining proper redox conditions during purification to preserve its native conformation and activity.

What analytical methods are most effective for assessing DsbD activity?

The assessment of DsbD's thiol:disulfide interchange activity requires specific methodologies:

In vitro Activity Assays:

  • Thiol-disulfide exchange can be monitored using fluorescent probes sensitive to redox state changes

  • Ellman's reagent (DTNB) can be used to quantify free thiol groups

  • Mass spectrometry can identify the redox state of specific cysteine residues

  • Enzyme-coupled assays linking DsbD activity to a detectable output (e.g., NADPH oxidation)

Structural Analysis:

  • Circular dichroism (CD) spectroscopy to assess secondary structure changes upon substrate binding

  • Intrinsic tryptophan fluorescence to monitor conformational changes

  • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

Interaction Studies:

  • Pull-down assays with potential partner proteins

  • Surface plasmon resonance (SPR) to measure binding kinetics

  • Isothermal titration calorimetry (ITC) to determine binding thermodynamics

How can we determine the role of DsbD in C. koseri's adaptation to different host environments?

Investigating DsbD's role in bacterial adaptation requires multifaceted approaches:

Experimental Setup for Environmental Adaptation Studies:

  • Generate dsbD knockout mutants using CRISPR-Cas9 or homologous recombination

  • Compare growth kinetics of wild-type and ΔdsbD mutants under various stress conditions:

    • Oxidative stress (H₂O₂, paraquat)

    • pH stress (acidic and alkaline conditions)

    • Temperature stress

    • Nutrient limitation

    • Host-mimicking conditions (serum, tissue cultures)

  • Perform transcriptomic analysis comparing gene expression patterns between wild-type and ΔdsbD strains

  • Use fluorescent redox-sensitive probes to visualize changes in periplasmic redox state

In vivo Relevance Assessment:

  • Animal infection models similar to those used for HPI cluster studies

  • Tissue culture invasion and persistence assays

  • Macrophage survival assays to assess intracellular persistence

  • Biofilm formation capacity under different environmental conditions

What are the structural determinants of substrate specificity in C. koseri DsbD?

Understanding the structural basis of DsbD substrate specificity represents an advanced research question:

Structural Analysis Approaches:

  • Generate a homology model based on known bacterial DsbD structures

  • Use site-directed mutagenesis to identify critical residues for function

  • Express individual domains of DsbD to assess their specific roles

  • Perform molecular dynamics simulations to identify potential substrate binding sites

Experimental Validation:

  • Cysteine-scanning mutagenesis coupled with activity assays

  • Heterologous complementation with DsbD from other species

  • Co-crystallization attempts with substrate proteins or peptides

  • HDX-MS analysis of conformational changes upon substrate binding

How does C. koseri DsbD compare with homologs in other Enterobacteriaceae species?

DsbD is generally conserved across Enterobacteriaceae, but species-specific variations exist that may relate to pathogenicity differences:

Comparative Analysis Methods:

  • Multiple sequence alignment of DsbD sequences from various Enterobacteriaceae

  • Phylogenetic analysis to identify evolutionary relationships

  • Domain architecture comparison to identify species-specific insertions or deletions

  • Comparative structural modeling to identify surface property differences

The table below summarizes key differences in DsbD across clinically relevant Enterobacteriaceae:

SpeciesDsbD Size (aa)Key Distinguishing FeaturesAssociated Pathologies
C. koseri~546Present in blaNDM-1 gene cluster in some isolates Neonatal meningitis, brain abscess
E. coli~547Well-characterized model systemVaried, including UTI, sepsis
K. pneumoniae~545Often associated with mobile genetic elementsPneumonia, UTI, sepsis
Salmonella spp.~546Contributes to intracellular survivalGastroenteritis, typhoid fever

What is the relationship between DsbD and antimicrobial resistance mechanisms in C. koseri?

The genomic context of dsbD in certain C. koseri isolates suggests potential links to antimicrobial resistance:

Research Approaches:

  • Compare dsbD expression levels in resistant versus susceptible isolates

  • Assess the impact of dsbD knockout on minimum inhibitory concentrations (MICs)

  • Investigate potential co-regulation between dsbD and resistance genes

  • Study the structural integrity of resistance-conferring enzymes in dsbD mutants

The presence of dsbD in the ISKpn19-blaNDM-1-ble-tnpF-dsbD-cutA-ISKpn19 cassette suggests a potential functional relationship with the NDM-1 metallo-β-lactamase, which confers resistance to carbapenems. This proximity may indicate:

  • Potential co-selection of dsbD with resistance genes during antibiotic pressure

  • Possible role in ensuring proper folding of NDM-1 and other resistance proteins

  • Contribution to fitness cost compensation in resistant isolates

Unlike some Citrobacter species that produce chromosomal β-lactamases like class C enzymes (C. freundii) or class A enzymes like CKO-1 (C. koseri), the specific relationship between DsbD and these resistance mechanisms requires further investigation .

What animal models are most appropriate for studying DsbD's role in C. koseri pathogenicity?

Animal models for C. koseri pathogenicity studies should be selected based on the specific research questions:

Validated Animal Models:

  • Neonatal rat model (2-day-old SD rats): Particularly useful for studying meningitis and brain abscess formation

  • 18-day-old BALB/c mice: An alternative model that has been validated for C. koseri CNS infection studies

Methodological Considerations:

  • For virulence studies, inoculation doses of ~5×10⁵ CFUs for 2-day-old SD rats and ~1×10⁷ CFUs for 18-day-old BALB/c mice have been established as effective

  • Monitor bacterial counts in both blood and cerebrospinal fluid

  • Assess bacterial replication capacity in brain tissue

  • Compare wild-type and dsbD mutants for survival rate in infected animals

  • Consider tissue-specific gene expression analysis using RT-qPCR

Research has demonstrated that deletion of virulence factors in C. koseri can lead to significantly decreased bacterial counts in CSF and reduced mortality rates in animal models . Similar approaches could be applied to study the impact of DsbD on pathogenicity.

How can transcriptomic and proteomic approaches enhance our understanding of DsbD function?

Multi-omics approaches provide powerful tools for comprehensive analysis of DsbD function:

Transcriptomic Approaches:

  • RNA-Seq analysis comparing wild-type and dsbD mutant strains under various conditions

  • Identification of differentially expressed genes in the dsbD regulon

  • Transcript analysis under infection-relevant conditions

  • Time-course expression studies during bacterial adaptation to stress

Proteomic Approaches:

  • Comparative proteomics of wild-type versus dsbD mutants

  • Redox proteomics to identify proteins with altered disulfide status

  • Protein-protein interaction studies using pull-down assays coupled with mass spectrometry

  • Secretome analysis to identify extracellular proteins affected by dsbD mutation

Integrated Analysis:

  • Correlation of transcriptomic and proteomic data to identify post-transcriptional regulation

  • Functional enrichment analysis to identify overrepresented biological processes

  • Network analysis to identify central nodes in DsbD-dependent pathways

  • Comparison with data from other Enterobacteriaceae to identify C. koseri-specific patterns

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.