Recombinant Citrobacter koseri Universal stress protein B (uspB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized formulations is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
uspB; CKO_04942; Universal stress protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Target Names
uspB
Target Protein Sequence
MISTVALFWALCVVCIVNMARYFSSLRALLVVLRGCDPLLYQYVDGGGFFTSHGQPNKQM RLVWYIYAQRYRDHHDDEFIRRCERVRGQFILTSALCGLVLISMVALLIWH
Uniprot No.

Target Background

Database Links
Protein Families
Universal stress protein B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Citrobacter koseri Universal stress protein B (uspB) and what is its significance in bacterial stress response?

Citrobacter koseri Universal stress protein B (uspB) is a member of the Universal Stress Protein (USP) family that is upregulated during various stress conditions including nutrient deprivation, oxidative stress, and osmotic shock. The protein plays a crucial role in bacterial adaptation to adverse environmental conditions. The uspB gene (locus tag: CKO_04942) encodes a protein of 111 amino acids with a molecular weight of approximately 12.5 kDa and an isoelectric point of around 5.2 .

The significance of uspB lies in its contribution to C. koseri's ability to persist in hostile host environments, such as the urinary tract or central nervous system. While uspB itself is not directly linked to virulence factors, its role in stress resistance indirectly supports bacterial survival under adverse conditions. This is particularly relevant considering C. koseri is a Gram-negative pathogen associated with neonatal meningitis and urinary tract infections .

How does the expression of uspB in C. koseri compare to other Universal Stress Proteins in Enterobacteriaceae?

The expression patterns of uspB in C. koseri share similarities with other Universal Stress Proteins found across Enterobacteriaceae. Research shows that:

  • Like other USP family members, uspB expression is significantly upregulated during various stress conditions, including oxidative stress, low pH environments, high salt concentration, and heat shock .

  • The uspB gene demonstrates sequence and functional conservation across related bacterial species, suggesting its evolutionary importance in stress adaptation mechanisms .

  • While specific expression patterns of uspB in C. koseri are not directly compared to other USP proteins in the search results, studies on related USP proteins (like UspF) in atypical enteropathogenic E. coli show that these proteins are expressed at similar levels across different strains but with notable differences when cultivated under various stress conditions .

  • The USP protein superfamily encompasses a conserved group of proteins involved in stress resistance in Enterobacteriaceae including C. koseri, E. coli, Shigella sonnei, and Citrobacter freundii .

What are the key experimental considerations when working with recombinant C. koseri uspB protein for stress response studies?

When designing experiments to study C. koseri uspB protein's role in stress response, researchers should consider the following critical factors:

Protein Stability and Storage Considerations:

  • Store recombinant uspB at -20°C/-80°C upon receipt, with necessary aliquoting for multiple use

  • Avoid repeated freeze-thaw cycles as they can significantly reduce protein activity

  • For short-term storage, working aliquots can be stored at 4°C for up to one week

  • The protein is typically stored in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) and aliquot for long-term storage

Experimental Stress Conditions:
Based on studies with related USP proteins, the following stress conditions can be used to examine uspB function:

  • Oxidative stress (e.g., H₂O₂ exposure)

  • Osmotic stress (e.g., 3M NaCl)

  • Acidic pH challenges

  • Heat shock conditions

It's crucial to include appropriate controls and to monitor bacterial growth patterns under each stress condition, as research with related USPs has shown that cultivation for extended periods (e.g., 24 hours) under severe stress conditions can completely abolish growth .

How does uspB contribute to C. koseri pathogenesis and survival in host environments?

While uspB is not directly classified as a virulence factor, research indicates it significantly contributes to C. koseri pathogenesis through several indirect mechanisms:

Oxidative Stress Response:
USPs like uspB are implicated in countering reactive oxygen species (ROS) by regulating redox-sensitive pathways, which is particularly important during macrophage phagocytosis where bacteria encounter oxidative bursts .

Iron Homeostasis Regulation:
Homologs of uspB in related bacteria (e.g., UspD in E. coli) modulate intracellular iron scavenging, which is critical for survival under iron-limited host environments such as the urinary tract.

Osmotic Adaptation:
USP superfamily members enhance bacterial tolerance to high salt concentrations, as observed in C. koseri and related Enterobacteriaceae. This adaptation is crucial for survival in various host niches with fluctuating osmolarity, such as the urinary tract.

Antimicrobial Resistance Connection:
Recent research suggests that stress conditions serve as molecular switches for usp gene expression, potentially contributing to antimicrobial resistance. The stress-mediated resistance process may allow C. koseri to resist antibiotic treatment and macrophage-phagocytosis, further complicating treatment of infections .

These mechanisms collectively enable C. koseri to persist in hostile host environments despite immune responses and treatment interventions, making uspB an important indirect contributor to pathogenesis .

What molecular interactions and signaling pathways are modulated by uspB during bacterial stress responses?

The molecular interactions and signaling pathways modulated by uspB during bacterial stress responses involve complex cellular mechanisms:

Protein Interaction Networks:

  • uspB likely interacts with ATP and cyclic AMP (cAMP) as binding partners, based on studies of related USP proteins

  • These interactions help map stress-response networks and signal transduction pathways activated during adverse conditions

Stress-Sensing Mechanisms:

  • The protein appears to function as a molecular switch that is triggered by specific stress conditions

  • Upon activation, uspB likely undergoes conformational changes that initiate downstream signaling cascades

Redox-Sensitive Pathways:

  • USPs like uspB are implicated in modulating redox-sensitive pathways to counter reactive oxygen species

  • This involves regulation of enzymes that detoxify harmful oxidative compounds and protection of cellular components from oxidative damage

Iron Regulation Pathways:

  • Homologs of uspB modulate iron scavenging systems, which are critical for bacterial survival

  • This regulation may involve interactions with iron-storage proteins and siderophore biosynthesis pathways

The interconnected nature of these pathways enables C. koseri to mount a coordinated response to various environmental stressors, enhancing its survival under adverse conditions including antibiotic exposure and host immune responses .

What expression systems and purification strategies are most effective for producing recombinant C. koseri uspB protein?

Based on current research practices, the following expression and purification approaches are recommended for recombinant C. koseri uspB:

Expression Systems:

  • Escherichia coli is the preferred expression host for recombinant uspB protein production

  • The pET-28a(+) expression vector system has been successfully used for USP family proteins and is suitable for uspB expression

  • Expression conditions: Typically induced with IPTG at mid-log phase (OD600 ~0.6-0.8) followed by incubation at 25-30°C to minimize inclusion body formation

Purification Strategy:

  • Affinity Chromatography:

    • His-tag fusion (either N-terminal or C-terminal) facilitates purification via nickel or cobalt affinity columns

    • Typical elution uses imidazole gradient (20-250 mM) in Tris-based buffers

  • Size Exclusion Chromatography:

    • Secondary purification step to achieve >90% purity as determined by SDS-PAGE

    • Useful for removing aggregates and ensuring homogeneous protein preparation

  • Buffer Optimization:

    • Final storage in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

    • Addition of 50% glycerol for long-term storage stability

Quality Control Parameters:

  • Purity: >90% as determined by SDS-PAGE

  • Identity confirmation: Western blotting with anti-His antibodies or uspB-specific antibodies

  • Activity assessment: ATP-binding assays or stress-protection functional assays

This methodological approach yields high-quality recombinant uspB protein suitable for structural studies, functional characterization, and interaction analyses .

What analytical techniques are most informative for characterizing uspB function and interactions?

Several complementary analytical techniques provide valuable insights into uspB function and interactions:

Structural Analysis:

  • X-ray crystallography or NMR spectroscopy to determine the three-dimensional structure and confirm the α/β configuration typical of USP family proteins

  • Circular dichroism (CD) spectroscopy to assess secondary structure composition and thermal stability

  • Limited proteolysis combined with mass spectrometry to identify domain boundaries and flexible regions

Interaction Studies:

  • Protein Interaction Assays: Pull-down assays and co-immunoprecipitation to identify binding partners (e.g., ATP, cAMP)

  • Surface Plasmon Resonance (SPR): To determine binding kinetics and affinities of uspB interactions

  • Isothermal Titration Calorimetry (ITC): For quantitative measurement of binding thermodynamics with potential ligands

  • Bacterial Two-Hybrid System: To screen for protein-protein interactions in a cellular context

Functional Characterization:

  • Stress Tolerance Studies: Growth assays under various stress conditions (oxidative, osmotic, pH, heat) comparing wild-type, uspB knockout, and complemented strains

  • ATP Binding and Hydrolysis Assays: To assess enzymatic activity and potential regulation by stress conditions

  • Gene Expression Analysis: RT-qPCR or RNA-Seq to monitor uspB expression levels under different stress conditions

  • Immunoblotting: To detect uspB protein levels during stress responses using specific antibodies

In vivo Studies:

  • Infection Models: Assessing bacterial survival and virulence in cell culture or animal models with uspB-deficient strains

  • Fluorescence Microscopy: Using fluorescently tagged uspB to monitor subcellular localization during stress responses

These techniques, used in combination, provide comprehensive insights into uspB function, regulation, and contributions to C. koseri stress adaptation and pathogenesis .

How can gene knockout and complementation strategies be optimized for studying uspB function in C. koseri?

Optimizing gene knockout and complementation strategies for studying uspB function in C. koseri requires careful experimental design:

Gene Knockout Approaches:

  • CRISPR-Cas9 System:

    • Design sgRNAs targeting specific regions of the uspB gene

    • Introduce a donor template with selection marker for homology-directed repair

    • Screen transformants using PCR and confirm by sequencing

    • Advantages: Precise editing, minimal polar effects

  • Lambda Red Recombineering:

    • Generate PCR products containing antibiotic resistance cassettes flanked by homology regions to uspB

    • Express the Lambda Red recombination system in C. koseri

    • Select recombinants on appropriate antibiotics

    • Confirm gene replacement by PCR and sequencing

    • Consider using FLP-mediated excision of resistance markers to create markerless deletions

Complementation Strategies:

  • Plasmid-Based Complementation:

    • Clone the uspB gene with its native promoter into a suitable shuttle vector

    • Transform the construct into the uspB knockout strain

    • Use different antibiotic markers for selection of knockout and complementation

    • Consider copy number effects: low-copy plasmids often provide more physiologically relevant expression levels

  • Chromosomal Integration:

    • Integrate uspB at a neutral site in the chromosome using site-specific recombination systems

    • This approach provides single-copy expression that better mimics native conditions

    • Can be accomplished using Tn7-based systems or phage attachment sites

Experimental Validation:

  • Expression Verification:

    • Use RT-qPCR to confirm absence of uspB transcript in knockout and restoration in complemented strains

    • Western blotting to verify protein levels match expected patterns

  • Phenotypic Characterization:

    • Compare growth curves of wild-type, knockout, and complemented strains under normal and stress conditions

    • Examine cellular morphology and ultrastructure using microscopy

    • Assess responses to specific stressors: oxidative stress (H₂O₂), osmotic stress (NaCl), pH stress, and heat shock

  • Control Considerations:

    • Include empty vector controls for plasmid-based complementation

    • Examine potential polar effects on neighboring genes

    • Consider creating point mutations in functional domains as an alternative to complete gene deletion

This comprehensive approach ensures reliable attribution of phenotypes to uspB function while minimizing experimental artifacts .

How can recombinant C. koseri uspB be utilized in antimicrobial resistance studies?

Recombinant C. koseri uspB offers several valuable applications for antimicrobial resistance studies:

Stress-Mediated Resistance Investigations:

  • uspB can serve as a molecular marker for stress-mediated resistance mechanisms, as stress conditions act as molecular switches for usp gene expression that support microbial survival

  • Researchers can monitor uspB expression levels during antibiotic exposure to understand the relationship between stress responses and antimicrobial resistance development

Target Validation Studies:

  • As bacterial stress responses contribute to antibiotic tolerance, uspB inhibition could potentially sensitize bacteria to existing antibiotics

  • High-throughput screening assays using recombinant uspB can identify compounds that interfere with its function or expression

Resistance Mechanism Characterization:

  • Comparing uspB expression and activity between antibiotic-susceptible and resistant C. koseri isolates can reveal the protein's contribution to resistance phenotypes

  • Structural studies of uspB can identify binding sites for novel adjuvant therapies that could disrupt stress adaptation

Biomarker Development:

  • Antibodies against recombinant uspB can be used to develop detection methods for monitoring stress response activation during antibiotic therapy

  • Elevated uspB levels could potentially serve as biomarkers for predicting treatment failure or resistance development

Experimental Approaches:

  • Use recombinant uspB in binding assays with antibiotics to identify potential direct interactions

  • Develop reporter systems using the uspB promoter to monitor activation of stress responses during antibiotic exposure

  • Compare transcriptomic and proteomic profiles of wild-type and uspB-deficient strains under antibiotic pressure

These applications provide valuable insights into how stress responses mediated by uspB contribute to C. koseri resistance to antibiotics, potentially informing new therapeutic strategies to combat resistant infections .

What is the potential of C. koseri uspB as a target for vaccine development?

While the search results don't specifically mention uspB as a vaccine target for C. koseri, the information provided allows us to evaluate its potential in this context:

Advantages of uspB as a Vaccine Target:

  • Conservation and Essentiality:

    • uspB appears to be conserved across strains and important for stress survival, suggesting it could provide broad protection against various C. koseri isolates

    • Targeting proteins essential for pathogen survival can reduce the likelihood of escape mutations

  • Role in Pathogenesis:

    • Though not directly linked to virulence factors, uspB contributes to C. koseri persistence in hostile host environments, making it a potentially effective target for reducing infection severity or duration

  • Epitope Prediction Approach:

    • Similar to the approach used for other C. koseri proteins, computational methods could identify B and T cell epitopes from uspB for multi-epitope vaccine development

    • Both CTL (cytotoxic T cell lymphocytes), HTL (helper T cell lymphocyte), and LBL (linear B cell lymphocyte) epitopes could be identified using immunoinformatic tools

Challenges and Considerations:

  • Immunogenicity Assessment:

    • The immunogenicity of uspB would need to be carefully evaluated to determine its ability to elicit protective immune responses

    • Recombinant uspB could be used in animal studies to assess antibody production and protective efficacy

  • Adjuvant Requirements:

    • As observed with other C. koseri vaccine candidates, an adjuvant (such as β-defensin) might be necessary to enhance immunological responses

    • Different adjuvant formulations should be tested to optimize vaccine efficacy

  • Expression System Optimization:

    • E. coli expression systems using plasmid vectors like pET-28a(+) have been successful for other C. koseri vaccine candidates and could be adapted for uspB-based vaccines

  • Validation Requirements:

    • In vitro and animal studies would be essential to validate the protective efficacy of uspB-based vaccines

    • Both humoral and cell-mediated immune responses should be evaluated

A comprehensive vaccine development approach would involve epitope prediction, peptide synthesis, immunogenicity testing, and protection studies in appropriate animal models before proceeding to clinical evaluation .

How can structural studies of uspB inform the development of novel anti-infective strategies?

Structural studies of C. koseri uspB can provide critical insights for developing novel anti-infective strategies through multiple approaches:

Structure-Based Drug Design:

  • Detailed 3D structures of uspB, particularly in complex with natural ligands like ATP, can reveal binding pockets suitable for small molecule inhibitor development

  • The α/β structural configuration of USP family proteins offers distinctive folding patterns that can be exploited for selective targeting

  • High-resolution structures would enable virtual screening of compound libraries against uspB to identify potential inhibitors

Functional Domain Targeting:

  • Identifying critical functional domains involved in stress response signaling can guide the design of peptide inhibitors or peptidomimetics

  • Domains involved in protein-protein interactions during stress response pathway activation represent valuable targets for disruption

Allosteric Inhibition Opportunities:

  • Structural studies can reveal allosteric sites that, when targeted, could prevent conformational changes necessary for uspB activation during stress

  • These sites often offer greater selectivity than active sites that may be conserved across protein families

Structure-Function Relationships:

  • Understanding how structural features correlate with uspB function in different stress conditions can guide rational design of stress-response modulators

  • Comparative structural analysis between uspB and human proteins can identify unique features for selective targeting

Experimental Design Considerations:

  • Structural Determination Methods:

    • X-ray crystallography of recombinant uspB in various states (apo, ATP-bound, etc.)

    • NMR studies for dynamic aspects of uspB function

    • Cryo-EM for larger complexes involving uspB and interaction partners

  • Functional Validation:

    • Site-directed mutagenesis based on structural insights to validate critical residues

    • Thermal shift assays to identify compounds that bind and stabilize uspB

    • In vitro activity assays measuring ATP binding/hydrolysis in the presence of candidate inhibitors

  • Translational Studies:

    • Testing of structure-based inhibitors in cellular models of C. koseri infection

    • Combination studies with conventional antibiotics to assess potential synergistic effects

By targeting the stress response mechanisms mediated by uspB, rather than conventional antibiotic targets, this approach may overcome existing resistance mechanisms and provide new therapeutic options for C. koseri infections .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.