Recombinant Citrobacter koseri UPF0208 membrane protein CKO_00500 (CKO_00500)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CKO_00500; UPF0208 membrane protein CKO_00500
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Target Names
CKO_00500
Target Protein Sequence
MSTPDNRSVNFFSLFRRGQHYAKTWPMEKRLAPVFVENRVIRMTRYAIRFMPPIAVFTLC WQIALGGQLGPAVATALFALSLPMQGMWWLGKRSVTPLPPSILNWFYEVRGKLQEAGQAL SPVEGKPDYQALADTLKRAFKQLDKTFLDDL
Uniprot No.

Target Background

Database Links
Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the predicted structure and function of Citrobacter koseri UPF0208 membrane protein CKO_00500?

The UPF0208 family membrane proteins in Citrobacter koseri are predicted to have transmembrane domains with alpha-helical structures similar to other bacterial membrane proteins. While the exact function remains to be fully characterized, structural analysis suggests roles in membrane integrity, transport, or signaling pathways. Based on homology with other Citrobacter membrane proteins, it likely contains multiple transmembrane domains and may participate in virulence mechanisms or environmental adaptation . Experimental approaches to confirm function may include gene knockout studies, localization experiments, and protein-protein interaction analyses.

How does CKO_00500 compare to other characterized membrane proteins in Citrobacter species?

CKO_00500 belongs to the UPF0208 family, distinct from other characterized membrane proteins such as the UPF0761 family (CKO_03126). Comparative analysis with proteins like the 32 kDa outer-membrane protein associated with C. koseri's neurotropism suggests potential structural differences . While UPF0761 membrane proteins like CKO_03126 (290 amino acids) have defined sequences with multiple transmembrane regions, the UPF0208 family may exhibit different topological characteristics and functional roles within the bacterial membrane. Researchers should conduct sequence alignment and phylogenetic analyses to better understand evolutionary relationships between these protein families.

What expression systems are optimal for producing recombinant CKO_00500 protein?

For the expression of recombinant Citrobacter koseri CKO_00500, E. coli-based expression systems similar to those used for other Citrobacter membrane proteins offer a starting point. The BL21(DE3) strain with T7 promoter-based vectors has shown success with related membrane proteins . Consider the following optimization parameters:

Expression ParameterRecommended ConditionsRationale
Induction temperature16-25°CReduces inclusion body formation and improves folding
IPTG concentration0.1-0.5 mMLower concentrations favor proper folding
Growth mediaTerrific Broth or 2XYTHigher cell density and protein yield
Induction OD6000.6-0.8Optimal cell density for membrane protein expression
Codon optimizationRecommendedImproves translation efficiency

For membrane proteins showing toxicity or poor expression, consider specialized strains (C41/C43) or cell-free expression systems for improved yields .

What purification strategies yield the highest purity and activity for CKO_00500?

A multi-step purification approach is recommended for CKO_00500, beginning with optimization of detergent extraction followed by affinity chromatography. Based on protocols for similar membrane proteins:

  • Membrane fraction isolation: Ultracentrifugation of lysed cells at 100,000×g for 1 hour

  • Detergent screening: Test panel including DDM, LDAO, and CHAPS at different concentrations

  • Affinity purification: His-tag based IMAC with specialized conditions for membrane proteins

  • Size exclusion chromatography: Final polishing step to achieve >90% purity

Critical parameters to monitor include:

  • Detergent-to-protein ratio during solubilization (typically 10:1)

  • Addition of glycerol (5-10%) to stabilize the protein

  • Use of reducing agents to prevent oxidation of cysteine residues

  • Inclusion of phospholipids during purification to maintain native-like environment

Validation of purified protein should include SDS-PAGE, Western blotting, and functionality assays appropriate to hypothesized function.

How can researchers overcome solubility challenges when working with CKO_00500?

Membrane proteins like CKO_00500 present significant solubility challenges. Implement the following strategies:

  • Fusion partners: Consider fusion with MBP, GST, or SUMO to enhance solubility

  • Systematic detergent screening: Create a matrix of detergent types and concentrations

  • Amphipol substitution: Replace conventional detergents with amphipathic polymers post-purification

  • Nanodiscs or liposome reconstitution: Transfer purified protein into lipid bilayer systems

For severe solubility issues, consider:

  • Truncation constructs removing problematic domains while preserving core structure

  • Addition of specific lipids (POPE, POPG) during purification

  • Co-expression with chaperones (GroEL/ES, DnaK/J)

Monitoring protein stability through thermal shift assays and dynamic light scattering throughout optimization is essential for successful reconstitution.

What is the recommended protocol for reconstituting CKO_00500 into liposomes for functional studies?

For functional reconstitution of CKO_00500 into liposomes, researchers should follow this methodological approach:

  • Liposome preparation:

    • Prepare lipid mixture mimicking bacterial membrane composition (typically POPE:POPG at 7:3 ratio)

    • Dissolve lipids in chloroform, evaporate under nitrogen, and resuspend in buffer

    • Freeze-thaw and extrude through 100 nm filters to form uniform liposomes

  • Protein incorporation:

    • Add purified protein at lipid-to-protein ratio of 100:1 to 1000:1

    • Remove detergent using Bio-Beads SM-2 or controlled dialysis

    • Verify incorporation via sucrose gradient ultracentrifugation

  • Functional validation:

    • Perform proteoliposome permeability assays with fluorescent dyes

    • Conduct ion flux measurements if transport function is suspected

    • Implement patch-clamp analysis for channel activity assessment

Monitor reconstitution efficiency through freeze-fracture electron microscopy and dynamic light scattering to ensure homogeneous distribution and proper orientation.

How can structural studies of CKO_00500 inform antimicrobial development against Citrobacter infections?

Structural characterization of CKO_00500 presents opportunities for targeted antimicrobial development against Citrobacter infections, which are increasingly concerning due to antibiotic resistance . Consider these methodological approaches:

  • Structural determination:

    • X-ray crystallography following LCP (Lipidic Cubic Phase) crystallization

    • Cryo-EM analysis for high-resolution structure without crystallization

    • NMR studies for dynamics and ligand interaction mapping

  • Structure-based drug design:

    • Virtual screening of compound libraries against identified binding pockets

    • Fragment-based approaches to identify initial chemical scaffolds

    • Molecular dynamics simulations to identify transient binding sites

Researchers should focus on unique structural features absent in human proteins to minimize off-target effects. The increasing carbapenem resistance in Citrobacter spp. (from 4% to 10% between 2000-2018) underscores the urgency of developing novel antimicrobials targeting membrane proteins .

What experimental approaches can differentiate between the roles of CKO_00500 and other membrane proteins in Citrobacter koseri pathogenesis?

To distinguish the specific contributions of CKO_00500 from other membrane proteins in C. koseri pathogenesis:

  • Gene knockout and complementation studies:

    • Generate clean deletion mutants using CRISPR-Cas9 or allelic exchange

    • Complement with wild-type and mutated versions under native promoter

    • Assess phenotypic changes in virulence models

  • Comparative infection models:

    • Utilize tissue culture invasion assays with neural cells (given C. koseri's neurotropism)

    • Implement Galleria mellonella infection model for initial virulence screening

    • Employ murine models for CNS infection assessment

  • Multi-omics approaches:

    • Transcriptomics to identify co-regulated genes during infection

    • Proteomics to map protein-protein interactions

    • Metabolomics to detect changes in bacterial or host metabolism

  • Specific protein localization:

    • Immunogold electron microscopy for precise cellular localization

    • Fluorescent protein fusions with minimal functional interference

    • FRET analysis for interaction with other virulence factors

These approaches should be implemented in parallel with controls targeting known virulence factors to establish relative contribution to pathogenesis.

How can researchers address discrepancies in CKO_00500 function between in vitro and in vivo studies?

When investigating functional discrepancies between in vitro and in vivo studies of CKO_00500:

  • Physiological context reconstitution:

    • Adjust experimental conditions to match in vivo environment (pH, ion concentration)

    • Incorporate host factors that may modify protein function

    • Utilize ex vivo tissue models as intermediate complexity systems

  • Time-resolved analyses:

    • Implement pulse-chase experiments to track protein dynamics

    • Develop inducible expression systems for temporal control

    • Use microfluidics platforms for controlled environmental transitions

  • Systematic validation approach:

    • Design validation experiments using multiple complementary techniques

    • Implement genetic reporter systems in different experimental contexts

    • Utilize CRISPR interference for partial knockdown phenotypes

  • Complex microenvironment considerations:

    • Assess function under oxygen limitation mimicking infection sites

    • Include relevant host cell types for co-culture experiments

    • Evaluate function in the presence of host immune factors

When interpreting contradictory results, consider post-translational modifications, protein-protein interactions, or microenvironmental factors that may differ between systems.

What are effective strategies for addressing antibody cross-reactivity issues when studying CKO_00500?

Antibody cross-reactivity presents significant challenges when studying membrane proteins like CKO_00500. Implement these methodological solutions:

  • Epitope mapping and selection:

    • Identify unique epitopes through sequence alignment with homologous proteins

    • Target extracellular loops or unique N/C-terminal regions

    • Perform competitive binding assays to confirm specificity

  • Validation protocol development:

    • Use knockout strains as negative controls

    • Implement heterologous expression systems for selectivity testing

    • Perform pre-adsorption tests with related proteins

  • Alternative detection strategies:

    • Epitope tagging at permissive sites determined through topology analysis

    • Proximity labeling approaches (BioID, APEX) for interaction studies

    • Mass spectrometry-based identification without antibodies

When developing custom antibodies:

  • Select peptide antigens with <70% similarity to other Citrobacter proteins

  • Test against multiple Citrobacter species to confirm specificity

  • Consider nanobody development for improved specificity

How can inconsistent expression levels of CKO_00500 across experiments be reconciled?

Variability in CKO_00500 expression can significantly impact experimental reproducibility. Address this methodologically through:

  • Standardized expression protocol:

    • Implement automated induction systems for consistent timing

    • Utilize bioreactors with precise control of growth parameters

    • Develop standard operating procedures with critical control points

  • Expression monitoring system:

    • Real-time monitoring using fluorescent reporter fusions

    • qPCR validation of transcript levels at standardized timepoints

    • Western blot quantification against stable reference proteins

  • Statistical approaches:

    • Implement power analysis to determine required biological replicates

    • Utilize mixed-effects models to account for batch variation

    • Normalize expression data against multiple reference standards

  • Cell line and condition normalization:

    • Develop stable cell lines with controlled integration sites

    • Implement strict quality control for media components

    • Consider continuous culture systems for greater stability

Document all experimental parameters meticulously, including cell density at induction, plasmid retention, and growth curves to identify sources of variability.

What analytical approaches can resolve contradictory functional data for CKO_00500?

When faced with contradictory functional data for CKO_00500:

  • Systematic methodological audit:

    • Evaluate all experimental variables between contradictory studies

    • Implement blinded analysis to minimize confirmation bias

    • Conduct inter-laboratory validation with standardized protocols

  • Multi-parameter analysis:

    • Apply principal component analysis to identify key variables

    • Utilize Bayesian approaches to integrate multiple data sources

    • Implement machine learning for pattern recognition in complex datasets

  • Orthogonal validation strategies:

    • Confirm results using complementary techniques with different principles

    • Develop genetic approaches to validate biochemical findings

    • Implement in silico simulations to test mechanistic hypotheses

  • Contextual functional assessment:

    • Evaluate function under different physiological conditions

    • Consider protein partners that may modulate activity

    • Assess impact of post-translational modifications on function

Create a comprehensive data integration framework that weighs evidence based on methodological rigor and reproducibility rather than simply voting between contradictory results.

How might CKO_00500 contribute to Citrobacter koseri's neurotropism and CNS infection capability?

Citrobacter koseri demonstrates unusual neurotropism, and membrane proteins could play key roles in this process. To investigate CKO_00500's potential contribution:

  • Neural cell interaction studies:

    • Develop binding assays with primary neural cells and cell lines

    • Utilize surface plasmon resonance to quantify binding kinetics

    • Implement CRISPR screening to identify host receptors

  • Blood-brain barrier (BBB) model systems:

    • Utilize transwell systems with brain microvascular endothelial cells

    • Implement microfluidic BBB-on-a-chip models for dynamic studies

    • Compare wild-type and CKO_00500 knockout strains for BBB penetration

  • Animal model investigations:

    • Develop neonatal rat models that recapitulate human CNS infection

    • Implement bioluminescent imaging for real-time infection tracking

    • Perform histopathological analysis with immunolocalization of CKO_00500

Current research suggests C. koseri's neurotropism relates to specific outer membrane proteins, including a 32 kDa protein . Comparative studies between CKO_00500 and this previously identified protein could reveal functional overlap or complementarity in neuroinvasion mechanisms.

What role might CKO_00500 play in antibiotic resistance mechanisms in Citrobacter species?

To investigate CKO_00500's potential involvement in antibiotic resistance:

  • Expression correlation analysis:

    • Compare CKO_00500 expression levels in resistant vs. sensitive isolates

    • Perform transcriptomic analysis under antibiotic pressure

    • Assess protein levels in clinical isolates with varying resistance profiles

  • Functional characterization approaches:

    • Overexpression studies to determine impact on MIC values

    • Knockout/knockdown experiments to assess sensitization

    • Site-directed mutagenesis of key residues to identify functional domains

  • Interaction studies with known resistance mechanisms:

    • Co-immunoprecipitation with efflux pump components

    • Bacterial two-hybrid screening for interaction partners

    • In situ crosslinking to capture transient interactions

The rising prevalence of carbapenem-resistant Citrobacter spp. (increased from 4% to 10% between 2000-2018 ) makes this investigation particularly relevant, especially if CKO_00500 interacts with efflux systems or participates in membrane permeability alterations.

Antibiotic ClassResistance Mechanisms in CitrobacterPotential CKO_00500 Involvement
CarbapenemsCarbapenemases (NDM-1, OXA-48)Altered membrane permeability
FluoroquinolonesQRDR mutations, plasmid-mediated resistanceEfflux pump interaction
AminoglycosidesModifying enzymes, target modificationMembrane potential maintenance
PolymyxinsLPS modificationsMembrane structure stabilization

How can comparative genomics and proteomics approaches enhance our understanding of CKO_00500 evolution and specialization?

Implement these methodological approaches to understand CKO_00500 evolution:

  • Phylogenetic analysis framework:

    • Construct maximum likelihood trees based on protein sequences

    • Implement Bayesian evolutionary analysis for divergence timing

    • Compare evolutionary rates between functional domains

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify regions under selection

    • Implement codon-based models to detect episodic selection

    • Perform ancestral sequence reconstruction for evolutionary trajectory analysis

  • Structural conservation mapping:

    • Apply homology modeling across diverse species

    • Map conservation scores to structural elements

    • Identify co-evolving residues through statistical coupling analysis

  • Horizontal gene transfer assessment:

    • Analyze GC content and codon usage patterns

    • Implement phylogenetic incongruence tests

    • Examine genomic context for evidence of mobile genetic elements

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.