Recombinant Citrobacter koseri UPF0283 membrane protein CKO_01392 (CKO_01392)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
CKO_01392; UPF0283 membrane protein CKO_01392
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Target Names
CKO_01392
Target Protein Sequence
MSEPLKPRIDFAGPLEVEQNQTLKTQQTFSETQAQTFAPAQVDEPLEDEGQAEAVIDAAL RPKRSLWRKMVMGGLALFGVSVVGQGVQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVA TEWRRLWRLRQRAHERDEARDLLHSHGTGKGRAFCEKLAQQAGIDQSHPALQRWYASIHE TQNDREVVSLYAQLVQPVLDAQARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFRLVLLNIAFAGASELVREVGMDWMSQDLAARLSARAAQGIG AGLLTARLGIKAMELCRPLPWIDDDKPRLGDFRRQLIVQVKETLQKSKTPREN
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is known about Citrobacter koseri that can inform CKO_01392 membrane protein research?

Citrobacter koseri is a Gram-negative, rod-shaped, facultative anaerobic bacterium from the Enterobacteriaceae family. It possesses distinctive virulence mechanisms primarily associated with flagellar apparatus biosynthesis and iron uptake systems. Notably, C. koseri contains a High Pathogenicity Island (HPI) gene cluster similar to highly pathogenic Yersinia strains, enabling iron acquisition in iron-deficient environments, which may explain its particular pathogenic effects on the central nervous system .

Unlike other Citrobacter species, C. koseri features a unique virulence factor profile where it possesses specialized Type VI secretion system genes (specifically T6SS-2) involved in colonization, survival, and invasion, but lacks several other secretion systems and the tad pilus found in related species . This distinct membrane protein profile suggests CKO_01392 may function within this specialized context, potentially contributing to C. koseri's unique pathogenic mechanisms.

What methodological approaches are recommended for initial characterization of the CKO_01392 membrane protein?

Initial characterization of CKO_01392 should follow a systematic multi-technique approach:

  • Bioinformatic analysis pipeline:

    • Transmembrane topology prediction using multiple algorithms (TMHMM, HMMTOP, Phobius)

    • Domain identification through Pfam, InterPro, and SMART databases

    • Sequence conservation analysis across Enterobacteriaceae to identify functionally important residues

    • Secondary structure prediction to guide experimental design

  • Initial expression testing:

    • Small-scale expression trials using C41(DE3) and C43(DE3) E. coli strains specifically developed for membrane proteins

    • Detergent screening panel (minimum: DDM, LMNG, GDN) for extraction optimization

    • Western blot analysis with N- and C-terminal tags to verify full-length expression

  • Functional prediction validation:

    • RT-PCR analysis of gene expression under varying conditions (iron limitation, host cell contact)

    • Co-expression analysis with genes in the same operon

    • Knockout/complementation studies to assess phenotypic impacts

These complementary approaches establish a foundation for advanced structural and functional studies while minimizing resource investment in non-productive methodologies.

What expression systems should be evaluated for recombinant production of CKO_01392?

The selection of an appropriate expression system for CKO_01392 requires systematic evaluation of multiple options, considering both the bacterial origin and membrane protein properties:

Expression SystemKey AdvantagesPotential LimitationsOptimization Strategies
E. coli C41/C43Phylogenetic proximity to C. koseri; well-established protocolsPotential toxicity; inclusion body formationLower induction temperature (16-20°C); test multiple promoter strengths
Cell-free systemsCircumvents toxicity issues; direct incorporation into nanodiscsHigher cost; optimization requirementsScreen detergent/lipid compositions; supplement with chaperones
Bacillus subtilisEfficient secretion of extracellular domainsLess effective for multi-spanning membrane proteinsOptimize signal sequences; test multiple integration vectors
Yeast (P. pastoris)Eukaryotic folding machinery; high-density cultureGlycosylation differences; slower growthClone multiple copy integrants; optimize methanol induction

How can researchers overcome common challenges in expressing full-length CKO_01392?

Based on general membrane protein expression challenges, several strategies can address difficulties with CKO_01392 expression:

  • Hydrophobicity management:

    • Fusion with solubility-enhancing partners (MBP, SUMO, Mistic) at either terminus

    • Co-expression with specific chaperones (GroEL/ES, DnaK/J)

    • Implementation of the membrane protein expression plasmid (pMESy) system

  • Translation optimization:

    • Codon optimization for expression host while maintaining rare codons at strategic positions

    • Implementation of dual-tag systems for N- and C-terminal detection to differentiate full-length protein from truncated products

    • Use of specialized ribosomes with enhanced capacity for difficult sequences

  • Toxicity mitigation:

    • Strictly controlled expression using titratable promoters (PBAD, Tet)

    • Growth in defined minimal media to reduce metabolic burden

    • Implementation of specialized expression strains with enhanced envelope stress responses

  • Extraction enhancement:

    • Systematic detergent screening using thermal stability assays

    • Membrane scaffold protein co-expression for nanodisc incorporation

    • Application of the MNP platform to extract high-purity nanoscale membrane particles while maintaining native conformation

These methodological approaches address the key challenges commonly encountered with bacterial membrane proteins and can be evaluated in parallel to identify optimal conditions for CKO_01392.

What purification strategies maintain the native conformation of CKO_01392?

Preserving the native conformation of CKO_01392 during purification requires careful consideration of the membrane protein environment:

  • Solubilization optimization:

    • Initial extraction using mild detergents (DDM, LMNG) with systematic CHS addition

    • Detergent exchange during purification to progressively milder options

    • Supplementation with E. coli polar lipid extract during all purification steps

  • Affinity purification adaptations:

    • IMAC purification with controlled imidazole gradients to separate full-length from truncated forms

    • On-column detergent exchange to avoid aggregation

    • Limited exposure to room temperature conditions

  • Conformational stability assessment:

    • Thermal shift assays to identify stabilizing conditions

    • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS) for homogeneity verification

    • Circular dichroism to confirm secondary structure integrity

  • Alternative solubilization approaches:

    • Amphipol exchange for detergent-free handling

    • Nanodisc reconstitution with varying lipid compositions

    • Styrene maleic acid (SMA) copolymer extraction for native lipid retention

The optimal purification strategy will balance yield with conformational integrity, requiring systematic optimization with small-scale parallel testing before scaling to production quantities.

How does membrane protein biogenesis inform CKO_01392 expression strategy design?

Understanding membrane protein biogenesis mechanisms provides crucial insights for designing effective CKO_01392 expression strategies:

  • Co-translational insertion pathway selection:

    • Membrane proteins insert through different pathways depending on transmembrane domain (TMD) characteristics

    • The Oxa1 family proteins insert TMDs flanked by short translocated segments

    • The SecY channel handles TMDs flanked by long translocated segments

    • Expression construct design should consider these insertion requirements

  • Membrane-proximal translation enhancement:

    • "Membrane-proximal protein synthesis facilitates co-translational insertion of multi-TMD proteins"

    • Expression constructs can incorporate ribosome-binding sequences that promote synthesis near membranes

    • This approach reduces exposure of hydrophobic domains to the cytosol, minimizing aggregation

  • TMD pair insertion facilitation:

    • Multi-TMD proteins insert most efficiently when "successively inserting TMD pairs as they emerge from the ribosome"

    • Expression rate modulation can synchronize with this natural insertion process

    • Lower temperatures (16-20°C) slow translation to match insertion capacity

  • Signal sequence optimization:

    • "A long segment of hydrophilic polypeptide can be translocated through SecY as long as it is preceded by a hydrophobic domain that engages SecY's lateral gate"

    • Optimizing the N-terminal signal sequence can improve insertion efficiency

    • Testing multiple signal sequence variants can identify optimal translocation

These biogenesis-informed strategies can significantly improve expression yield and proper membrane insertion of CKO_01392.

What computational tools are most effective for predicting CKO_01392 structure?

Recent advances in computational biology have dramatically improved membrane protein structure prediction capabilities:

  • AI-based structure prediction:

    • AlphaFold2 and RoseTTAFold represent breakthrough technologies for protein structure prediction

    • These tools can generate highly accurate models even for membrane proteins with limited homology

    • For CKO_01392, both whole-protein prediction and domain-based modeling should be performed

    • Models should be evaluated using pLDDT scores and ranked by confidence metrics

  • Molecular dynamics validation:

    • Predicted structures should be embedded in simulated membrane environments

    • Extended simulations (>100ns) can identify unstable regions requiring refinement

    • Analysis of water penetration patterns can verify transmembrane domain boundaries

  • Integrative modeling approaches:

    • Combining predictions with experimental constraints from crosslinking or EPR data

    • Evolutionary coupling analysis to identify co-evolving residue pairs as distance constraints

    • Template-based modeling using structural homologs, even with low sequence identity

As noted in the literature, "with the development of AI-based protein structure prediction technologies such as AlphaFold2, the ability of these technologies to predict the three-dimensional structure of unknown proteins will become even more powerful in the future" . This represents a paradigm shift in membrane protein structural biology, providing unprecedented insight into proteins like CKO_01392.

How can researchers experimentally validate topology predictions for CKO_01392?

Experimental validation of membrane protein topology requires multiple complementary approaches:

  • Fusion reporter strategy:

    • Strategic fusion of topology-sensitive reporters at predicted loops

    • PhoA (alkaline phosphatase) fusions: active only when located in periplasmic space

    • GFP fusions: fluorescent only when located in cytoplasm

    • Dual reporter system with both markers provides bidirectional validation

  • Cysteine accessibility methodology:

    • Introduction of single cysteine residues at predicted loop regions

    • Sequential labeling with membrane-permeable and impermeable reagents

    • Mass spectrometry analysis of labeling patterns

    • Quantitative assessment of accessibility under varying conditions

  • Limited proteolysis mapping:

    • Controlled protease digestion of purified protein

    • Mass spectrometry identification of protected versus exposed regions

    • Comparison with computational predictions to refine models

    • Time-course analysis to identify dynamic regions

These empirical approaches provide direct experimental evidence of membrane topology that can confirm or refine computational predictions, establishing a solid foundation for functional studies of CKO_01392.

How should researchers distinguish between structural and functional roles of conserved residues in CKO_01392?

Differentiating between residues with structural versus functional importance requires systematic analysis:

  • Evolutionary conservation pattern analysis:

    • Multiple sequence alignment across diverse bacterial species

    • Calculation of conservation scores using programs like ConSurf

    • Analysis of conservation patterns within specific bacterial clades

    • Identification of co-evolving residue networks

  • Structure-guided mutagenesis design:

    • Alanine scanning of conserved residues, categorized by predicted location

    • Conservative versus non-conservative substitutions to probe tolerance

    • Charge reversal mutations at potential functional interfaces

    • Expression and folding assessment prior to functional testing

  • Differential stability analysis:

    • Thermal stability comparison between wild-type and mutant proteins

    • Chemical denaturation profiles to assess folding energy differences

    • Hydrogen-deuterium exchange mass spectrometry to identify protected regions

    • Correlation between conservation and structural stability

This multi-faceted approach allows researchers to develop a detailed map of CKO_01392 residue functions, distinguishing those critical for structural integrity from those involved in specific functional interactions or catalytic activities.

How might CKO_01392 contribute to Citrobacter koseri pathogenicity?

Analysis of C. koseri virulence mechanisms suggests several potential pathogenicity roles for CKO_01392:

  • Potential iron acquisition involvement:

    • C. koseri possesses a High Pathogenicity Island (HPI) gene cluster enabling iron uptake in iron-limited environments

    • Many membrane proteins participate in siderophore reception or iron transport

    • CKO_01392 could function in iron sensing, transport, or regulation

    • Experimental approach: Growth studies under iron limitation with/without CKO_01392 deletion

  • Type VI secretion system association:

    • C. koseri contains T6SS-2 genes involved in "colonization, survival, or invasion"

    • Membrane proteins often form essential components of secretion systems

    • CKO_01392 could participate in assembly, substrate recognition, or regulation

    • Experimental approach: Co-immunoprecipitation studies with known T6SS components

  • CNS infection mechanism:

    • C. koseri shows "remarkable pathogenic effects on the CNS"

    • Membrane proteins can mediate adhesion to specific host tissues

    • CKO_01392 might participate in neural cell interaction or blood-brain barrier crossing

    • Experimental approach: Brain endothelial cell adhesion/invasion assays with CKO_01392 mutants

  • Stress response and antimicrobial resistance:

    • C. koseri has acquired resistance to multiple antibiotics

    • UPF0283 family proteins often have stress-response functions

    • CKO_01392 might contribute to envelope stress responses or antibiotic resistance

    • Experimental approach: Susceptibility testing under varying stress conditions

These hypotheses provide a framework for systematic functional investigation of CKO_01392 in C. koseri pathogenesis.

What genetic manipulation strategies are most effective for studying CKO_01392 function?

Genetic approaches to study CKO_01392 should be designed with consideration of potential essentiality and functional redundancy:

  • Clean deletion methodology:

    • Two-step allelic exchange using counter-selectable markers

    • CRISPR-Cas9 genome editing for scarless mutations

    • Complementation testing with wild-type gene under native and inducible promoters

    • Growth rate analysis across diverse environmental conditions

  • Conditional expression systems:

    • If deletion is lethal, implement regulated promoters (tetracycline-responsive, rhamnose-inducible)

    • Depletion experiments with quantitative phenotypic analysis

    • Protein degradation tags for rapid post-translational depletion

    • Time-course analysis of physiological effects following depletion

  • Domain-focused mutagenesis:

    • Targeted mutation of predicted functional domains

    • Conservative substitutions to maintain structure while altering function

    • Charge reversal mutations at potential interaction interfaces

    • Construction of chimeric proteins with homologs from non-pathogenic species

  • Reporter fusions for localization:

    • C-terminal fluorescent protein fusions preserving native N-terminus

    • Verification of fusion protein functionality through complementation

    • Subcellular localization under varying environmental conditions

    • Co-localization studies with known virulence factors

These genetic tools provide complementary approaches to elucidate CKO_01392 function in both laboratory and infection-relevant conditions.

How can protein-protein interaction studies identify functional partners of CKO_01392?

Identifying interaction partners of membrane proteins requires specialized approaches:

  • In vivo crosslinking methodology:

    • Photo-crosslinking with non-natural amino acids incorporated at predicted interaction sites

    • Chemical crosslinking with membrane-permeable reagents of varying spacer lengths

    • Mass spectrometry identification of crosslinked partners

    • Controls with non-functional CKO_01392 mutants to confirm specificity

  • Co-immunoprecipitation adaptations:

    • Similar to techniques used in case study 4 from search result , where "TSHR antibody pulls down TSHR and CD40, and CD40 antibody also pulls down both proteins, indicating physical contact"

    • Detergent optimization for membrane protein extraction

    • Chemical crosslinking prior to solubilization

    • Quantitative comparison between experimental and control conditions

  • Bacterial two-hybrid systems:

    • BACTH (Bacterial Adenylate Cyclase Two-Hybrid) system optimized for membrane proteins

    • Split-ubiquitin yeast system as an alternative approach

    • Screening against genomic fragment libraries

    • Validation of positive interactions through reciprocal constructs

  • Proximity-based labeling:

    • APEX2 or TurboID fusion to CKO_01392 for proximity labeling

    • Time-controlled labeling to identify transient interactions

    • Comparison of interaction profiles under varying conditions

    • Bioinformatic filtering against control datasets

These complementary approaches can reveal CKO_01392's interaction network, providing crucial insights into its functional role within C. koseri's pathogenic mechanisms.

What approaches help determine if CKO_01392 plays a role in antimicrobial resistance?

Given that "Citrobacter genus acquired antimicrobial resistance and virulence" , investigating CKO_01392's potential role in resistance requires multiple experimental strategies:

  • Transcriptional response analysis:

    • RT-qPCR measurement of CKO_01392 expression following antibiotic exposure

    • RNA-seq comparison between resistant and susceptible isolates

    • Promoter-reporter fusions to monitor regulation under antibiotic stress

    • ChIP-seq identification of transcriptional regulators binding the CKO_01392 promoter

  • Resistance phenotype assessment:

    • Minimum inhibitory concentration (MIC) determination for mutant versus wild-type strains

    • Time-kill kinetics under various antibiotic concentrations

    • Post-antibiotic effect duration measurement

    • Biofilm formation and antibiotic tolerance assessment

  • Mechanistic investigations:

    • If CKO_01392 functions as an efflux component: fluorescent substrate accumulation assays

    • If involved in envelope integrity: membrane permeability measurements

    • If participating in stress response: reporter systems for envelope stress pathways

    • Antibiotic binding studies with purified protein

  • Clinical isolate correlation:

    • Sequence analysis of CKO_01392 across resistant clinical isolates

    • Expression level comparison between resistant and susceptible strains

    • Complementation studies with variants from resistant isolates

    • Statistical association between mutations and resistance phenotypes

These systematic approaches can establish whether CKO_01392 contributes to the antimicrobial resistance mechanisms documented in Citrobacter species.

How can single-cell techniques advance our understanding of CKO_01392 function during infection?

Single-cell approaches provide unique insights into protein function during host-pathogen interactions:

  • Intracellular infection visualization:

    • Fluorescent protein fusions to monitor CKO_01392 localization during infection

    • Live-cell imaging with environmental responsive reporters

    • Super-resolution microscopy for nanoscale distribution patterns

    • Four-dimensional tracking (x, y, z, time) throughout infection cycle

  • Single-cell protein expression analysis:

    • Flow cytometry with permeabilization and antibody staining

    • Mass cytometry (CyTOF) for multi-parameter analysis

    • Microfluidic single-cell western blotting

    • Correlation between expression levels and bacterial phenotypes

  • Host-pathogen interface examination:

    • FRET-based sensors to detect protein-protein interactions at bacterial-host interface

    • Split fluorescent protein complementation across bacterial-host membranes

    • Correlative light and electron microscopy for ultrastructural context

    • Optogenetic manipulation of CKO_01392 function during active infection

  • Single-cell transcriptomics integration:

    • Dual RNA-seq of host and pathogen from individual infection events

    • Correlation between CKO_01392 expression and host response genes

    • Trajectory analysis of expression changes throughout infection cycle

    • Identification of bacterial subpopulations with distinct expression profiles

These approaches overcome population averaging limitations, revealing heterogeneity in CKO_01392 function and expression during host interaction that would be masked in bulk analyses.

What emerging technologies are transforming bacterial membrane protein research?

Several cutting-edge technologies are revolutionizing membrane protein research and could be applied to CKO_01392:

  • AI-based structural biology:

    • Deep learning approaches like AlphaFold2 provide unprecedented structural prediction capabilities

    • As noted in the literature, these technologies "will become even more powerful in the future"

    • Integration of predicted structures with sparse experimental data

    • Virtual screening against predicted structures for functional ligands

  • Cryo-electron microscopy advances:

    • Single-particle analysis reaching near-atomic resolution for membrane proteins

    • Cryo-electron tomography visualizing proteins in native membrane environments

    • In situ structural determination within bacterial cells

    • Time-resolved cryo-EM capturing conformational transitions

  • De novo protein design applications:

    • Custom-designed protein tools based on CKO_01392 structure

    • The literature notes that "deep learning techniques has made it possible to design completely new proteins from scratch"

    • Creation of conformation-specific binding proteins as research tools

    • Design of inhibitors targeting specific functional states

  • Nanobody-based technologies:

    • Development of conformation-specific nanobodies against CKO_01392

    • Intracellular expression for real-time functional manipulation

    • Crystallization chaperones for structure determination

    • Therapeutic targeting of essential membrane proteins

These emerging technologies create unprecedented opportunities for understanding membrane proteins like CKO_01392, potentially revealing unexpected functions or creating new research tools based on its structure.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.